Identifiers and Description

Gene Model Identifier

Contig19162.0.g35

Standard Name

ASMT1

Aliases

Contig19162_0_g35

Description

Maf-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004447809.002954397174899e-30maf protein
SGDYOR111W8.996157222146379e-27YOR111W SGDID:S000005637, Chr
XV from 530429-531127, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19162.0.g35(coding)
ATGTTATTGCCGCTACTCGACAAGCTAAACAGCAAAAGTATAATTTTGGCATCAGCATCT
GCAAACAGAAAACAAATCCTTGAAAAATCAGGTTTAGTTTTTACTCAATCTCCCTCAACC
TTCGAAGAAAACATGCCCCACTCAGATTTCGCAACAAGCATTGATTACGTAGTAAAAAAC
ACTGAAATGAAATTCCTAAACAAACTTACTGAAATTAAGTAGAAACTTGAACAATCTGAC
AATACAAGTGTTGTGGAGTTTGCTGATATAATCATTGCAGCAGATACTATCATTTCACTT
GATGGCAAGTAAATTGTGGAGAAACCACTGGATAAATCCCACGCATTCCAAATGCTTATG
AAATACAACGACTATGAATATCATGAAGTACAGACAGCTGTTGTAATTGGTTTTATAAAC
AGAGACACCGCATAAATTATAAATTAACAAACTCTAGTTGACATTACCAAAGTATATTTC
GAGAAGATTGATGAAGCCACAGCTATGGCTTACGTGGAGAGTGGAGAGCCCTTCGGGAAA
GCAGGTGGTTATGGAATACAGGGATAAGCAGCCACTTTGATCAAGAAAATAGAGGGAGAC
TACTATAATGTATGGGGATTCCCACTCAACAGGTTTTGCAGCAAGATCAAGGAGATGCTC
TAAGAAATTGATTAATAAGAAGAGTTAAAGCAGCAGTGA


>Contig19162.0.g35(protein)
MLLPLLDKLNSKSIILASASANRKQILEKSGLVFTQSPSTFEENMPHSDFATSIDYVVKN
TEMKFLNKLTEIKQKLEQSDNTSVVEFADIIIAADTIISLDGKQIVEKPLDKSHAFQMLM
KYNDYEYHEVQTAVVIGFINRDTAQIINQQTLVDITKVYFEKIDEATAMAYVESGEPFGK
AGGYGIQGQAATLIKKIEGDYYNVWGFPLNRFCSKIKEMLQEIDQQEELKQQ