Identifiers and Description

Gene Model Identifier

Contig18508.0.g43

Standard Name

ASCC3b

Aliases

Contig18508_0_g43

Description

Sec63 Brl domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003020609.997093137033517e-262Type III restriction enzyme, r
es subunit fami...
SGDYER172C9.997093137033517e-262BRR2 SGDID:S000000974, Chr V f
rom 536021-529530, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18508.0.g43(coding)
ATGACTGACAAAGAAGTCTAGAGGACTTAGTATAAGTACACTCTTAACTCAAATTTGGTT
ATCCAAGGGTAGTCAAACTAGAACAGAGAAAATGAACCATCTGGTGAGGGAGAGACTCTT
ACTGGAAGAAAGTTGGCGCCTTTTGGTGATAAAGTTCAAAGAGAGAAGCCTCCCGAACTC
ACTAAAGCCAAGGATCAAAAAAAGCAAGACACTAAGAAAAAGCAAGATAGAGATATCATG
AATTCAAAGAGAGAAACTCAATTTAGTATGGCTAGTGGTTCAGAAAAGAACATCTTGAAT
GCTCAAATCCAAGAGGATTTAGTCTATAGACCTAAGACTAAAGAGACAAGAGCAATCTAT
GAGACCATCCTCACAATTGTGCAAAAGCACATGGGTGATAATTCACTTGAAGTGCTTAGA
GGAGCCACTGAAGAAGTCATAGCACTCTTAAAGACAGAGAATATCAATGACTCCGATAAA
AAGAAAGAGATTGAGGGCATCATTGATAGAATGAGTTCAGAGACATTCAATCAACTGGTT
GTGCTCTCTTAATAACTGGTTGACTATAATCCTGAGGATGAACTCAGAGAAAACTAGAGA
GAGCAGTAAATTGATGTCAATTTCGAGGCTGAAGATGATGAAGATGCTGCTGACGATGAA
GATCAGCTTGAAGTCAAAGGCTAGGATGAAGAAGCAGAGGATCAAGAAGAAAAGAAAGAG
AAGTAAGAAGATGAGGATGCAGATCTGGATGAAGAAGATATTGAAATATAATAAAAAGAG
GCATCAAAGAACAAAGATCAATTGAGTTTCTAGGACATTGATGCATTTTGGCTCTCTAGA
CTGTTAATGGAGCATTTTAAAGATCAAATGGCTGAAGAATAGTAAGAACTCGAAAGAAAA
CTCATGAATGTTTTGAAAATTTAAAATCCTAGAGAATGCGAGAGAAAGATTCTTGCAGTT
ATTGGTCCAGAAAAGTATGATCTCATTCCTATGCTAGTTAAGAATAAGAATGTGATATAC
TACTCCACAAGATACAATCAGGCTTAAGATGAAAAATAGAAAGCTCTAATCATTCAAGAG
CTAGAAACTTTTCCAGAGGGTAGGGAAATTGTTGATCAAATTATTGGAAGAGCCGGTAAT
ACAGAGGCTGAGCTAAGTAAATCGTTGCTTGACGATGCAAAGAATTTAACTAAAAAGTAT
AGAGCTCCAACAGCTGAAGATGTAACAGATTTGCTTTAGAAAAAGGTTACCGATGAAATC
TTAAGCAGCACAAAAGGAGCTAAGCAACTTGACTTAGAAAACATTTCCTTCTAGTAAGGT
GCTAGATTAATGGCTAATAAAAAGTGTCTACTTCCTAAAGGTTCTTAAAAGATCACAAAA
GTTGGTTACGAGGAAGTTTATGTCCCTGCTACTAGACATAAATACAAGGATGACGTGAAA
CTCATTCCTATATCAGATTTACCGGAATGGGCTAGACCTGCATTCCCTGCACCTATAACA
AATCTGAATTTTATCTAGAGTAAGGTTTATGAAAGTGCCTTCAAAAGTAACGAAAACTTG
CTGATTTGCGCTCCAACTGGAGCTGGAAAAACAAATATTGCCTTATTGTCAATTCTTTAA
GTGTTAAACATGAAGAGAAAGAGCAATGGTAGATTTGATATTAAAAACTTTAAGATAGTT
TACATCGCACCAATGAAAGCTCTGGTAACTGAGGTTGTAGGTAATTTCTAGAAGAGACTT
GATAGCTTTGGTATCACAGTAAAAGAACTTACTGGTGATGTTCATTTGACTAAAGCTCAA
ATTGATGAAACTTAAATTATAGTAACTACTCCTGAAAAATGGGATATTATTACAAGAAAG
AGTGGAGATAGAGCTTTCTTAGATCTTGTTAAGTTAATCATTATTGATGAAGTACATCTC
TTGCATGATTCAAGAGGTCCTGTTCTAGAAGCAATCGTAGCAAGAACGATAAGACAGATA
GAAAACACATCGGAAAATATAAGAATAGTTGCTTTGTCTGCTACTTTACCTAACTATCAA
GATGTTGCAGCATTTTTAAGAGTAAGACCTGAGACAGGCCTTCATTAGTTTGACAATTCA
TTCAGACCAGTTCCATTAGAACAAATCTATGTTGGAATCACTGAGAAAAAAGCAATCAAG
AGATTAATGCTTATGAATGAAGTTTGTTATGAAAAAGTTATGGAAAGAGCTGGAAAACAT
CAAATTTTGATATTTGTTCATTCAAGAAAAGAGACAGCAAGAACTGCTAAAATTATCAGA
GATATGGCACTTGCTAAGGATGAATTACATAAATTTATTGGGGAATAATCATTAACAAAA
GACCTGCTTGATCAAGAAAGTTAAAATGCATAAAGCATAGACATGAAGGACTTATTACCA
TATGGTTTGGGTATACATCATGCTGGTTTGGCCAGAAAAGATAGACTTATGGTTGAGTAA
CTTTTTGCAGCTGGCCATCTACAAGTCCTTGTTTCAACAGCTACTCTAGCTTGGGGAGTT
AATCTTCCTGCACATACAGTCATCATTAAAGGAACTCAAATTTACAGCCCTGAGCAAGGC
AAGTGGATAGAACTAAGCCCTTAAGATATGCTTTAAATGATGGGAAGAGCCGGTAGACCA
CAATATGATACATTAGGTGAAGGTATAATTATTACCAACTACTCTGAACTGCAATATCAC
TTAAGTTTAAATAATTAACAACTCCCAATCGAAAGTCAACTTATCACATAGTTGCCAGAT
TAGCTTAATGCAGAAGTTGTCTTAGGAACAGTATCAAATGTTAAAGAAGCCATAAATTGG
TTAGGTTATTCCTATCTCTATATCAGAATGTTAAGAGCTCCCTCTTTATATGGAATAGAT
GAGGCTGAGATTCAGAGAGACCCCTTGCTCGTATAAAGAAGAGCTGACCTTATTCACACA
GCTGCGCTTATGCTTTCTAAAGCTCAAATGATTAAATACGATAGAAGAACTGGAGCTTTG
TAATCTACTGCAATTGGTAAAGTTGCTTCTCATTACTACATTAAGCATAGTTCTATGAGC
ATTTATAATGAGAATCTAAAGCAGTACATGAATATAATTGATGTATTCAGATTATTTGCG
CTTTCAAAAGAGTTTCAGTTTATTCCAATAAGAGAAAATGAAAAGCTAGAGTTGGTGAAA
TTTATTGATAAAGTACCCATTCCAGTCAAAGGAGCTTTAGATGAAACTGCAACTAAGATT
AATATATTACTTCAAGCTTATATCAGTAGATTCAAACTTGAAGGGTATGATCTTAATGCT
GATATGGTTTATGTAACTTAAAGTGCTGGAAGAATCCTAAGATGCTTATTTGAGATATGC
ATCAAAAGAGGTTGGGCTTAGTTAAGTGAAATTTTACTTAATATGTGTAAGATGGTAGAG
AGAAGATAATGGAGCTCAATGACACCTTTGAGACAATATCATGGTATTCCTGAAGAAATC
CTAAGAAAAATTGAGAAAAAAGAGCAGTTTACATGGTAACATTTTTATGAAATGACTCCT
TAACAAATTGGAGAAATCGTTAAATTCCCAAAAATGGGCAAAGTCATTCATAAACTGGTT
CATTAATTCCCAAAACTAGAGCTAGAAGCCTATGTTTAACCAATAACGAGAACAATAATC
AAAGTTGAACTAGCTCTTACACCAGACTTTTAATGGGAATAAAAAATTCATGGAAAAGCT
GAACCTTTTTGGGTACTTGTTCTAGACTCTGACTCTGAGCAAATTTTACACTCAGAATAA
TTCATCTTGAAAGATAGGGACGTAGGCGAACAATAAATTCTCTCATTTACAATCCCTCTT
TATGAACCTATGCCACCATAATACTTTATCAAAGTTATATCAGATAGATGGCTATAATCT
GAAACAACACTTCCTGTCTCCTTCAAGCATTTGATTTTACCTGAAAGATTCCCACCGACT
ACTGAAATTCAGGATATGCATTCAAAGCTTGTCAGAGAACTTCAATTCAAAGAAGCAGAA
GATTTATATATAAGCGAAAATATCAATGAATTCAATGCAATTCAGACATAATCATTCAAC
AAGGTATATCTCTCGGATGAATCAGTTTTTATTGGGGCACCAAGTGGATCCCAAAACATA
ATATGCGCAGAATTAGCTATATTTAGAGAAATTTAGAAGGATGACTTAAAGAAAATAGTT
TATATTGCTCCAAATGAGCATCTTCTTCTCAATAGATTTGAAGACTGGAAAGAAAGACTT
GGAACTTAAATAGGTCTAAGAGTCGAAAAATTGACTGGTATTTTGCAACAAGACATTCAA
ATCTTGAATAGCGCTGACATTATTTTGAGTACCCCAGATAAATGGGACTTCCTGTCAAGA
AAATGGTAATTAAGAAAAATTGACTAGAAAGTTGGTTTATATATTTTCGATGAGCTATAG
TTGATTCCCGAGTCTGGAGCAGTTTATGAAATAATTGCAAGTAGAACTAGATATATTCAG
AATGAAGGAGAAAACAGAAATATTAGAATCATTGCTCTAGCTACTCCAATTGCAAACTCA
AAGGACATCGCAAACTGGTTAGGCATACCCTTCCCTGCAAACACATTTAACTTTCACCCA
AGTGTAAGACCTACTCCTTTAGAGATCCATATTTAAGGTTTTGATCATAATAACAAGGCA
ACTAGAACTCTTGCTATGGAAAGACCAGCTTATAATATTCTTAAAAAGAACTTGAACATA
AGAACAGACTCTCAAGGAATCATATTCGTCTCTGATAGAAAGCAAGCGAGACTTCTAGCT
TTAGACCTAATTAACTTTGTCTCAAGCGATGAAAATCCATAAAGGTTCTTAAATCTTGAA
AGCGATAAAGAAAAGCAAGAATTCCTTAACTAAGTACAAAGATAGGTGAATGAAACAACT
TTACTTTCATCATTAGAGTATGGAATTGGATTTATTCATGATGGAATGAAAAACAACTAG
ATCTAATACATTAAGGATCTATACAAATAAGGCATTTTCAGAGTATTGATAGCAATCTAC
ACTTTTTCATGGAGAATCTCAGATCTTGAGTCTCATGTAGTCATTATCCTCGATGCTGAA
AGATATCATGGAGAAGAAAAGAGATTTGTTGAATATAGCATCCCAGACATGCTGTAAATG
ATGGGAAGAGCAAATGTTACATAAGCTCTAGGAAGAGGAGGACCACAGCTCGCAGCGAAG
TGCATTTTATATTGCCACACCCCAAGAAAAGATTATTTCATCAAATTCCTGCAAGAGCCA
TTGCCAGTTGAATCTCACCTCGATCATCATCTTCATGATCATTTAAACGCTGATATTGCT
GCTGGAACTATCGAAAATAAGTAGGATGCTATTGATTGGATAACTTGGACTTTTATGTAC
AGAAGAATTTCTCAGAATCCAAACTACTATAACCTAGCTGGAAAAACAGGTTAACACATT
AATGATCACTTGAGTGAGTTAATTGAGCAAACTGTTGAGGACTTACAAAAGGCAAAATGT
ATAGAAGTGGCAGAGGATGAAATGGGCTTAGAGATTGCTAATCTTGGAAGAATAGCTGCG
TTCTATTACATAAAGTATCAAACAATTGAAACTTTTTCAAAGAATCTAGAAGATGAATCA
ACACTCAATAAGAAATTGAAGGCCTTGATTGAGGTATTATCTTAAGCCTCAGAATTCGAG
TAAACTCCTATTAGAATTGGCGAAGAATCTTTACTCAAGTCTCTGACAACTTATCTAACA
TATCCAATTGAAGTTGAAAATGATGTGCAATACAACACAGCACCAGTCAAAACAAATCTC
CTCCTTCAATGTCACTTCAACCGCACACCTTTAAATATAGACATGAGAATCGATCAGGAG
ATGATACTTAAATAGTCAATTAAGCTTATTCACGCCATGGTAGATGTTATCAGTTCACAT
GGATACTTGAAACCTGCTTTGCTCTGTATGGAGCTTTCACAAATGACAGTCTAATCTATG
TGGGTAACTTAATCCCCTCTTCTCTAACTTCCAGGATTTGACTCTAGCATTGTAGATCAA
ATGAAGAAAGTGAAAGTTGAGGACATTGTTGATTTTATGAATATGGATGATGATTTAAGA
GAGAAGATCCTAAACTTCAATGAAAAGGAAATGGCTAAGCTCGCTAATGTTTGCAGCAGA
TATCCAAATGTTGAAATGGAGTTTACCACCAAAGAAAAGTCATATCAAGAGGGATAAGTT
GCAGAACTCTAAGTAAAGATTGTGAGACCTAACATTGAAGATGATGAAGAGTTGCAAGTT
TTCAACAAGCCAGTCTACGCTTAATATTACCCAGGAGAAAAGGAAGAGAATTGGTGGGTA
GTTGTCGGCTAACCAAGGCATAACAAGCTGTTGTCAATCAAGAAAATTACTTCCTTCAAA
GCTCAAAGAGAGATTCAGTCATCACTTAACTTTGTAGTGAAATCAGACGGCCACACAGGT
CCACAAGAATACAAAGTCTATTTGATATGTGATTCATACATCGGCTGTGATCAAGAAGAT
ATCTTGACTATTTAAGTCAAGTGA


>Contig18508.0.g43(protein)
MTDKEVQRTQYKYTLNSNLVIQGQSNQNRENEPSGEGETLTGRKLAPFGDKVQREKPPEL
TKAKDQKKQDTKKKQDRDIMNSKRETQFSMASGSEKNILNAQIQEDLVYRPKTKETRAIY
ETILTIVQKHMGDNSLEVLRGATEEVIALLKTENINDSDKKKEIEGIIDRMSSETFNQLV
VLSQQLVDYNPEDELRENQREQQIDVNFEAEDDEDAADDEDQLEVKGQDEEAEDQEEKKE
KQEDEDADLDEEDIEIQQKEASKNKDQLSFQDIDAFWLSRLLMEHFKDQMAEEQQELERK
LMNVLKIQNPRECERKILAVIGPEKYDLIPMLVKNKNVIYYSTRYNQAQDEKQKALIIQE
LETFPEGREIVDQIIGRAGNTEAELSKSLLDDAKNLTKKYRAPTAEDVTDLLQKKVTDEI
LSSTKGAKQLDLENISFQQGARLMANKKCLLPKGSQKITKVGYEEVYVPATRHKYKDDVK
LIPISDLPEWARPAFPAPITNLNFIQSKVYESAFKSNENLLICAPTGAGKTNIALLSILQ
VLNMKRKSNGRFDIKNFKIVYIAPMKALVTEVVGNFQKRLDSFGITVKELTGDVHLTKAQ
IDETQIIVTTPEKWDIITRKSGDRAFLDLVKLIIIDEVHLLHDSRGPVLEAIVARTIRQI
ENTSENIRIVALSATLPNYQDVAAFLRVRPETGLHQFDNSFRPVPLEQIYVGITEKKAIK
RLMLMNEVCYEKVMERAGKHQILIFVHSRKETARTAKIIRDMALAKDELHKFIGEQSLTK
DLLDQESQNAQSIDMKDLLPYGLGIHHAGLARKDRLMVEQLFAAGHLQVLVSTATLAWGV
NLPAHTVIIKGTQIYSPEQGKWIELSPQDMLQMMGRAGRPQYDTLGEGIIITNYSELQYH
LSLNNQQLPIESQLITQLPDQLNAEVVLGTVSNVKEAINWLGYSYLYIRMLRAPSLYGID
EAEIQRDPLLVQRRADLIHTAALMLSKAQMIKYDRRTGALQSTAIGKVASHYYIKHSSMS
IYNENLKQYMNIIDVFRLFALSKEFQFIPIRENEKLELVKFIDKVPIPVKGALDETATKI
NILLQAYISRFKLEGYDLNADMVYVTQSAGRILRCLFEICIKRGWAQLSEILLNMCKMVE
RRQWSSMTPLRQYHGIPEEILRKIEKKEQFTWQHFYEMTPQQIGEIVKFPKMGKVIHKLV
HQFPKLELEAYVQPITRTIIKVELALTPDFQWEQKIHGKAEPFWVLVLDSDSEQILHSEQ
FILKDRDVGEQQILSFTIPLYEPMPPQYFIKVISDRWLQSETTLPVSFKHLILPERFPPT
TEIQDMHSKLVRELQFKEAEDLYISENINEFNAIQTQSFNKVYLSDESVFIGAPSGSQNI
ICAELAIFREIQKDDLKKIVYIAPNEHLLLNRFEDWKERLGTQIGLRVEKLTGILQQDIQ
ILNSADIILSTPDKWDFLSRKWQLRKIDQKVGLYIFDELQLIPESGAVYEIIASRTRYIQ
NEGENRNIRIIALATPIANSKDIANWLGIPFPANTFNFHPSVRPTPLEIHIQGFDHNNKA
TRTLAMERPAYNILKKNLNIRTDSQGIIFVSDRKQARLLALDLINFVSSDENPQRFLNLE
SDKEKQEFLNQVQRQVNETTLLSSLEYGIGFIHDGMKNNQIQYIKDLYKQGIFRVLIAIY
TFSWRISDLESHVVIILDAERYHGEEKRFVEYSIPDMLQMMGRANVTQALGRGGPQLAAK
CILYCHTPRKDYFIKFLQEPLPVESHLDHHLHDHLNADIAAGTIENKQDAIDWITWTFMY
RRISQNPNYYNLAGKTGQHINDHLSELIEQTVEDLQKAKCIEVAEDEMGLEIANLGRIAA
FYYIKYQTIETFSKNLEDESTLNKKLKALIEVLSQASEFEQTPIRIGEESLLKSLTTYLT
YPIEVENDVQYNTAPVKTNLLLQCHFNRTPLNIDMRIDQEMILKQSIKLIHAMVDVISSH
GYLKPALLCMELSQMTVQSMWVTQSPLLQLPGFDSSIVDQMKKVKVEDIVDFMNMDDDLR
EKILNFNEKEMAKLANVCSRYPNVEMEFTTKEKSYQEGQVAELQVKIVRPNIEDDEELQV
FNKPVYAQYYPGEKEENWWVVVGQPRHNKLLSIKKITSFKAQREIQSSLNFVVKSDGHTG
PQEYKVYLICDSYIGCDQEDILTIQVK