Identifiers and Description

Gene Model Identifier

Contig1737.0.g35

Standard Name

ASCC3a

Aliases

Contig1737_0_g35

Description

Sec63 Brl domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010344009.997093137033517e-262Type III restriction enzyme, r
es subunit fami...
SGDYGR271W9.997093137033517e-262SLH1 SGDID:S000003503, Chr VII
from 1031791-1037694, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1737.0.g35(coding)
ATGGTGGATTCAGAGCCTAGAGAAAGATTCAGATTTACTACGTTCTTACGTTAAAAGATC
AGAGAGCAGAAGATTCAGAAATACGGAGTAAACTCTCCGATGGTGCCTCCTTAGCGATTA
ACTTATCAGTAAGAGTTGAAGGAGATGGGCAAGAGAAATGTAAATGTCAAAAAGTCTTAT
GAATTAGAGAGACAAGGACTAGTACCTAACCCTTATCTCTTCGAAGCAGAAGCTGAACTC
ATGAAGCATGCTAAGATGTCAAAGGCGTCAAATTGGAACAATCTTTACAACTAATTCTTG
GATAAATCTAGACGCTTGGACAAGCCTGCTCAAATGGCAGACACCTATGTTTTGGCTAGA
GTTTACAAATTTGTGCTTTTCAAGACTGGCAAAGAGGAAGTGTCCTAAGATTTAGAAAAA
GACTATTTTATGTTCTAGGGAATGTATCAACAGAGACTTGATTCTCAAAAGATGCTAGAC
ATCGAATCACTTTGTCATCAGTTGTTTGCCCATAAAGATCAAATCATGAAGTCTGAGTAG
CAGCCAGATATCCTTGAGCAAAATGGGTTCAAATACAATGATTCAGTGTTTGATGACCTC
TATGTTAAATCCTTCCAAGAGACTATGTTTAATAACTCAACCGACTCAAGCGAAGAGGAA
ACCTTTGAAGAAGAAAAAAAGGGCGGTGGAGCATCTGAAGTTCAGCCCTAAAAGAAAGCA
GTCATTACTAAAGATGACTTCTTAGTAGATAGTACCGAAGATTCGAGGTTAAACCAATCT
TAGAGAGTTAACTAAAAGCAAGTCGATAGAGATTTGTTCAATTTGGATGAGGATTCTAAG
AGCTCATCCTAGATTCAATCATCTTATGTAGAAGAGGAGGAGGAAGAAGAACCTGAAATT
GACATTGACTCATTAGACCCTGACAAAGTAAACTGGTTCAAGTATATTACTGACAAATAT
CTCAGCCTTAAAGATGAAGATGGAAATGAATCAGCACTCTAAAATGCCGATGCCTATGTC
AACCTTCTCAACATTTTGCTGAGCAACAAACCAAATGAAGAGATTTAAGAAGACTTGCTT
AACCTGGTTGGCTATCATAACTTTGAATTGTTGATGAAATTAATAGAGAGAAGAGACATT
ATCAAGGAACAATGTAAAGTGATCAACGAAAAATTATAGAGCGAAAAGTAGCAAGACGGC
TACAAGTCTAAAAACATGGGAGGTCCAATTATGGTTGGAGCTTCAGTAGAAGTCAGAGGT
GGCAAAAAGGGAAAGAAGAAGGGACCTAATCCGGCTTAAATGGAAACCTTGAAGATAAAC
AACTATGAAATATTAAAGAGATTAGGCTTTGATAGAGACTTTATTGATGAGTAGAAGAGA
CTAGGGCTTCAACAGTAATAATTAGAAAGACGACAAAACATGAATGAGTACCTAATGGAA
GAAAAAGAGAGAAGAAAGGCAGTAGGATCATCAAATGTCTTTGAGAAGCCAATGGAAAAG
AAAAACTACTAAGAAATCACAGAAGAAAATGATGAGTTCAAGTACATTTAGATAATCCCT
CCACCCAAACCCAAACACTCAAATGCAGAATTAGTACCAGTAGTAGACCTCCCACCTTAT
GCCCGTAAAGCATTTGGCAGCACTCAATACTTGAATCGTATTTAATCTGCAGTATATTAA
ACTGCCTTTAAATCTAATAGAAATTTACTCATTTCTGCTCCAACTGGTGCTGGTAAGACC
AATATCGCCTTACTCACTATTTTGAGGGAAGTTTCTCAGCATATAGAGGATAACATGACT
AATGACTAAAAAAGCTGGGATATGTCCCTTAAAAGCTTCAAGATCATCTATATTGCACCC
CTTAAAGCTCTCGCATCAGAAATCGTACAAAAGTTCCAAACTGCTTTAGCTTACTTGAGA
ATTTAAGTTAGAGAACTTACTGGAGATATCAACATGGGTAAGCAAGAGATTTAAGAAACT
CACATTATCGTTTCAACTCCAGAGAAATGGGATGTTGTGACAAGAAAGAGTGATGGAATG
ATGGACATGGTGAATGTTATGATTATCGATGAAATCCATCTTCTGAATGATGAAAGAGGT
CTAGTTCTAGAGTGTCTCGTTGCAAGAGCATTCATGACAAGTAGCAAAATTCAAAAACCA
ATTAGAATTGTTGGACTATCCGCTACATTGCCCAACTACGAAGATGTTGCGAGATTCATT
GGAGCAGAGGGACCAGGTACTTTCTACTTTGATGCTAGTTATAGACCAACTCCACTTAAA
TGTGCTTTCTATGGAATCAAAAACCTGGGAAATGCTCAAAGAGCCAACAATATCATGAAT
GATATTATTTATCATGAACTCAAGAGAATCTTGAGAATGGGAAAGCAAGTTATTATCTTC
GTTCATAAGAGAGCTGAGACTCATACCACAGCTAAAGAATTAATAGAAATATTGGCAAAG
AGACCACATGACAGAGATCTATTTGATTGTGAAAGATCATACACTGTAAAAACTGAAGTA
TAGAGATCTAAAAATGAGCAAGTTAAAGCACTTTTCGAACATGGTTTTAGCATCCATAAT
GCAGGTTTGCTCAGAAAAGATAGAAACCTAGTCGAAAAAATGTTCCTCGATGGCCACATT
AAAGTTCTCTGCTCAACTGCTACTCTCGCTTGGGGTGTTAACTTACCAGCCTATGCAGTA
ATTATCAAAGGTACTAAGATGTACGATTCAGCTACAGGAACATACAAAGATATTGGAGTT
TTCGATGTACAGCAAATTTTCGGTAGAGCTGGTAGACCTCAATTCGATAATGAGGGTGAG
GCAATTATCTTGACACTGATTAAAGAAATGGATGATTATGTTAAAATCATGAGTAATAAG
CAAAATATCGAAAGTAACTTGTACAAAGGACTTGATAATTGTATTAATGCTGAAATTTCA
GGAGGTACAATTGGCACATTAACTGACGGTATTCATTGGTTGAAAAAGACTTACTTTTAT
CAAAGAGTAACCAGAAACCCAGTTGCCTACGGTATAAACTAAAAGCAAATCTACGATGAT
CCCACTGCTCATTTCATTCTATATGAGAAAGTCACTGAGACTGTAAGAAGACTTAATAGA
ATGCAATTGATCAGATATAACGAATAAACTGAGACAGTTTATGCTACAGATATGGGAAGA
ATCGCTAGTAACTATTACATTGATTGTGAAACTATGAGCTACTATATGGAAAATCTTAAA
CCACACACTTCAGAGCAAATCATGATGTATCACTTGGCTCAATCAAGTGAGTTTAAATAG
ATGGATGCAAGAAAAGAAGAACATGATGAATTGAAGAGACTTATGAATGATGTCAGATTC
TTTGATGTCGATAAGAACATTTTCAATGAAGCCCATACCAAGGTACTTGTCCTTTTTGAA
GCTTATCTCAGAGACCTATAATTAAAGACTTTCAGTTTAATCTCAGATATGGCTTACATA
GTGCAAAATGCTGCAAGACTTCTTAGAGCTATCTTTGAAATTGCTATGAACAAAAACTAT
GCCCTATTGGCTAAAACTGCACTGAGATGGTGTTAAATCCTAGATAAGCGTTTGAGACCA
ATAGATCATCCACTTAAATAGATGACAATTTATTCAAGCGTTGGAAAACTAACAAATCAA
AACAATAAAGTTACCAAGTATGGTTATCTAAGTGATGAGGTTGTGTTTAGAGTAAAAGCT
GCTGATTTGACTCTTGACTAGATATACAATAACGAGCTAGAGTCAGTAAGCAGATAGCTA
GGTCCAAATGGCATTGAAGAATTAAAGAAATTTGTTTCATATATACCATATCTAGAGGTA
GAAGTGACAGTAATGCCAATTACTAGAGCAATTTTAAAGGTTAACCTTAATATTACTCCT
AACTTTGAATGGAACGACAGATGGAATGGAAAGAGCGAGCCATTCTGGATTATAGTTGAT
AACGATAGTGAAATTTTGCATTCAGAATTTTTCGTACTTCACAAAGCAGATATTAAGAAG
TTTAAGAAGGGCAACAAAACATTAATTAAAAATGAATCAGAAATAAACTTGACTTTCTTC
GTACCTTATGAAGTATCAGAAGGGGAAAAGAGAATTGCTTTAGGCTCATACTATAATGTT
CATATCTTATCTGACAGATGGTTTGACATATCATTTTGGAGTTAAATAGAGCTCTCTGAA
ATTTAAGTACCTGATGAGGACTATCCACACACTAAACTTTTGAATTTGAGACCTCTAGCT
ATTAAAGCTTTGAACAATGAAAAATTCGAACAACTATATTCTTCAAAGAACATTAATTTC
TTCAACCCAGTCCAAACTTAAGTTTTTCATACTCTCTTCCACACTGATTCAAATGTTTTA
ATTGGAGCACCTACTGGTTCTGGTAAAACTATTATGTCAGAATTTGCTATGCTAAGAGTC
TTTAAGAATTATCCAGATTCTAAGATTATTTATGTTGCTCCTCTTAAGGCACTAGCTAAA
GAAAGAATTTCAGATTGGAAGAAACGTTTATAAGAAGGACCTTTAGGTAAAACAGTGCTT
GAATTGACTGGTGACTTTACACCTGATTTGAAGGCACTTAAAAGTGCTGATATTCTTATT
ACTACGCCTGAGAAGTGGGATGGTATCTCTCGTAATTGGTAACATCGTTCTTATGTACAA
TAAGTAGCACTTGTTATCATTGATGAAATACATTTGCTTGGGTAAGAAAGAGGTCCAGTT
ATTGAAGTTATTGTAAGTAGAATGAGATATATCTCAGAGCAAACTGGAAACAGTGTGAGA
TTTGTAGGTTTGTCTACAGCACTTGCTAATGCTAAGGATGTAGCTGATTGGTTAGGAATT
CATAAACTTGGCCTATATAACTTTAAGCCAAGTGTCAGGCCAGTACCAATTAAAGTCTTC
TTTGAAGGCTTTTCTGAAAAGCATTATTGCCCTAGAATGGGTACTATGAATAAACCAGCA
TTTAAAGCAATTATGACTCATTCAAAAGATCACCCAGTCCTAATTTTCGTATCATCAAGA
AGATAGACAAGATTGACTGCTTTAGATTTAATTGCTCTCTGTGCCGCTGATCAACAAGAA
AGAGAGGGCTATGATATAGATATTTTCAAGAGACCTTTCCTTAAGATGGACCCTGAAGAA
ATTTATCATATTTCAGAATTGATTAAAGATGAAAACTTGAGATAGACCATAAACTATGGA
GTAGGAATGCATCATGCTGGTCTTACAGAGAATGACAGAAAGATAGTTGAGGACTTGTTC
GTAAAGAAGAAAATTCAGGTTTTAGTCACTACCAGTACTTTAGCTTGGGGTGTTAATTTC
CCAGCTAGATTGGTTATCATCAAGGGTACTGAATTCTTTGATCCTAAAGTAAGAAGATAT
GTTGACTTCCCACTCACTGACTTATTGCAAATGATTGGAAGAGCAGGTAGACCACAGTTC
GATGAGACAGGTTATGCTTGTGTATTTGTTCATGAAGAGAAAAAGAACTTCTACAAGAAA
TTCCTCTATGAACCCTTCCCAGTTGAATCATCATTGTAAGGCTAAATAGTGGACCACTTA
AACGCTGAGATTGCTAGTGGAACTTTACTAACTAATTAGAATTGCATTGATTACTTGACT
TGGACTTACTTCTTCAGACGCTTGACTAAGAATCCAGCTTACTATAAATTGAAGAAAAAC
GATGCAACTGAAATCAACACATACTTAAAAGCTATGGTTAATGATAGTTTATCCAAATTG
GTTAATGCTAAATGTATTGAATATAACAGTGAGGATCATACTGTTAGTAGTACTACTCTA
GGAAGATTAGCCTCTTTCTATTATCTATCGCATGAGACTATCTAATTTATGAATGATAAA
ATAGGAAACAATGATTCAGTAGCTACGCTTCTAAATACTTTAGCATATGCTAAGGAGTTC
TCAGGATTGCCTGTCAGACATAACGAAGATGTTCTTAACGAAGCCTTGACTCACTTAGTC
CCATTAAGAGTAGCAAAGCACGACCTTGAAAACCCACATGTAAAAGCAAACTTACTAATC
TAAGCTCACTTAGAACGCTGCCCACTCCCAATCACTGATTATATTACAGATACCAAAATG
GTCTTAGACCAATCAATCAGAGTATTACAAGGTATGATTGATGTTAGTTCACATAAGGGA
CACTTGAACTCAACCCTTAACTTAATCCACTTAATGCAAATGATAGTTCAAGGTTAGTGG
TTAGATTAATCACCATTAATGAATGTTCCTCATTTTACTGGAGATACACTCAGGAAGCTT
CATTCTAGAGGCATTGATTACTTGCAGCAGCTAACATATAGATCAAAGAACGACCCTGCC
AAATTATTGAATACAGATTTGAAATGCAACTTTGATAGCACCTAAATCAAAGAAATCACA
AAAGCTCTTGATAGAATACCACAGATTTAAATCAAATACTCAATCGTTGCTATTGATGAC
AAGAGCTAGCCACTAGAAAATGAAAAACTATCCGAGGGAGGAGAGGCTATGATAGTTGTA
AACTTAAAACGCTTCAATAAAGCTATAAAATAAAAAGCTCTGATCTCTCATTTCCCCAAA
CCCAAAGAACCTGGCTATTTCTTAGTGATTGCAAACTCTACAAGCAATGACATCTTGGCT
ATGAAGAGAGTCACTTTTAACAGATTCGCTACTAAGAATTTAAGCATCGTGCTTCCTGAA
GATTTCACTTATGAGAAGCTTGAATTGCACCTGTTATGTGATACCTATATTGGGTTGGAC
TAATGCTATCAAATAGACTTGAACTAAATCAATGAAGTAATCTAAGGAAAGATTAAGATT
GAAGAATGGAGAAAGTAGTAGGCTAAATAAGCTCAAGTTTAATCTCAACCTTAAAAGTAA
GGCAGACAGCAACAAAATCAAAACGAAAGTTTCTTCACTAAAGTTGGAGAAGAAGAGGGA
GAAAATGAAGCAGGCTTCTCATTATTTGGAAACCTTCAAGGTCAGATTATTGATGATATT
CAAGATGAGGATGATGTTCAGATGCAAGACCAGATTAAGAGAGGCATCAATGCCATACTT
GATGACGATGATATGGATGATGATGAAGACTTTGACAATATGATTGAAAAAGATTTGGAT
AATTGGTTCTGA


>Contig1737.0.g35(protein)
MVDSEPRERFRFTTFLRQKIREQKIQKYGVNSPMVPPQRLTYQQELKEMGKRNVNVKKSY
ELERQGLVPNPYLFEAEAELMKHAKMSKASNWNNLYNQFLDKSRRLDKPAQMADTYVLAR
VYKFVLFKTGKEEVSQDLEKDYFMFQGMYQQRLDSQKMLDIESLCHQLFAHKDQIMKSEQ
QPDILEQNGFKYNDSVFDDLYVKSFQETMFNNSTDSSEEETFEEEKKGGGASEVQPQKKA
VITKDDFLVDSTEDSRLNQSQRVNQKQVDRDLFNLDEDSKSSSQIQSSYVEEEEEEEPEI
DIDSLDPDKVNWFKYITDKYLSLKDEDGNESALQNADAYVNLLNILLSNKPNEEIQEDLL
NLVGYHNFELLMKLIERRDIIKEQCKVINEKLQSEKQQDGYKSKNMGGPIMVGASVEVRG
GKKGKKKGPNPAQMETLKINNYEILKRLGFDRDFIDEQKRLGLQQQQLERRQNMNEYLME
EKERRKAVGSSNVFEKPMEKKNYQEITEENDEFKYIQIIPPPKPKHSNAELVPVVDLPPY
ARKAFGSTQYLNRIQSAVYQTAFKSNRNLLISAPTGAGKTNIALLTILREVSQHIEDNMT
NDQKSWDMSLKSFKIIYIAPLKALASEIVQKFQTALAYLRIQVRELTGDINMGKQEIQET
HIIVSTPEKWDVVTRKSDGMMDMVNVMIIDEIHLLNDERGLVLECLVARAFMTSSKIQKP
IRIVGLSATLPNYEDVARFIGAEGPGTFYFDASYRPTPLKCAFYGIKNLGNAQRANNIMN
DIIYHELKRILRMGKQVIIFVHKRAETHTTAKELIEILAKRPHDRDLFDCERSYTVKTEV
QRSKNEQVKALFEHGFSIHNAGLLRKDRNLVEKMFLDGHIKVLCSTATLAWGVNLPAYAV
IIKGTKMYDSATGTYKDIGVFDVQQIFGRAGRPQFDNEGEAIILTLIKEMDDYVKIMSNK
QNIESNLYKGLDNCINAEISGGTIGTLTDGIHWLKKTYFYQRVTRNPVAYGINQKQIYDD
PTAHFILYEKVTETVRRLNRMQLIRYNEQTETVYATDMGRIASNYYIDCETMSYYMENLK
PHTSEQIMMYHLAQSSEFKQMDARKEEHDELKRLMNDVRFFDVDKNIFNEAHTKVLVLFE
AYLRDLQLKTFSLISDMAYIVQNAARLLRAIFEIAMNKNYALLAKTALRWCQILDKRLRP
IDHPLKQMTIYSSVGKLTNQNNKVTKYGYLSDEVVFRVKAADLTLDQIYNNELESVSRQL
GPNGIEELKKFVSYIPYLEVEVTVMPITRAILKVNLNITPNFEWNDRWNGKSEPFWIIVD
NDSEILHSEFFVLHKADIKKFKKGNKTLIKNESEINLTFFVPYEVSEGEKRIALGSYYNV
HILSDRWFDISFWSQIELSEIQVPDEDYPHTKLLNLRPLAIKALNNEKFEQLYSSKNINF
FNPVQTQVFHTLFHTDSNVLIGAPTGSGKTIMSEFAMLRVFKNYPDSKIIYVAPLKALAK
ERISDWKKRLQEGPLGKTVLELTGDFTPDLKALKSADILITTPEKWDGISRNWQHRSYVQ
QVALVIIDEIHLLGQERGPVIEVIVSRMRYISEQTGNSVRFVGLSTALANAKDVADWLGI
HKLGLYNFKPSVRPVPIKVFFEGFSEKHYCPRMGTMNKPAFKAIMTHSKDHPVLIFVSSR
RQTRLTALDLIALCAADQQEREGYDIDIFKRPFLKMDPEEIYHISELIKDENLRQTINYG
VGMHHAGLTENDRKIVEDLFVKKKIQVLVTTSTLAWGVNFPARLVIIKGTEFFDPKVRRY
VDFPLTDLLQMIGRAGRPQFDETGYACVFVHEEKKNFYKKFLYEPFPVESSLQGQIVDHL
NAEIASGTLLTNQNCIDYLTWTYFFRRLTKNPAYYKLKKNDATEINTYLKAMVNDSLSKL
VNAKCIEYNSEDHTVSSTTLGRLASFYYLSHETIQFMNDKIGNNDSVATLLNTLAYAKEF
SGLPVRHNEDVLNEALTHLVPLRVAKHDLENPHVKANLLIQAHLERCPLPITDYITDTKM
VLDQSIRVLQGMIDVSSHKGHLNSTLNLIHLMQMIVQGQWLDQSPLMNVPHFTGDTLRKL
HSRGIDYLQQLTYRSKNDPAKLLNTDLKCNFDSTQIKEITKALDRIPQIQIKYSIVAIDD
KSQPLENEKLSEGGEAMIVVNLKRFNKAIKQKALISHFPKPKEPGYFLVIANSTSNDILA
MKRVTFNRFATKNLSIVLPEDFTYEKLELHLLCDTYIGLDQCYQIDLNQINEVIQGKIKI
EEWRKQQAKQAQVQSQPQKQGRQQQNQNESFFTKVGEEEGENEAGFSLFGNLQGQIIDDI
QDEDDVQMQDQIKRGINAILDDDDMDDDEDFDNMIEKDLDNWF