Identifiers and Description

Gene Model Identifier

Contig2028.0.g106

Standard Name

ASATOR

Aliases

Contig2028_0_g106

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam10707 ) PhoP regulatory network protein YrbL
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007034003.001290106883431e-24Protein kinase domain containi
ng protein
SGDYNL154C2.999758165421992e-18YCK2 SGDID:S000005098, Chr XIV
from 345276-343636, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2028.0.g106(coding)
ATGTAAAGTATCTACTAAAACCTTCCAAATTAGTTATCTAATAACTAGATAGAAGCAAAC
ACCATTCTGAAAAATAGATACATACTTAAGCAAGAACTTGGTCAAGGTTCATTTAGACAA
CCTCATATTGTTCGAACATATGGATTTGAGAATCAAGAAGCTTACAACATGGAAAACTTC
ATAGTAATGGATTTGAAAGGAATAAATTTAGCAAACTATAAAAAATAATAGAAGATACAA
TCAGAACTACATGCATTGGACATTTTACTCTAAGCTCTATAAGCTATTTAAGATATGCAT
TAAGAAGGAATCATTCATCGGGATGTCAAACCTTCAAACTTTGTGATGGGAAGCAGACCT
GAAGAGTAAGAAAAAGTCTTCCTAGTGGATTTTGGGTTAGCAAAAGATCACATAGATAAA
TATACTGGAAGACCTCAAGAAGCAAGAAAAAATATAGATTTCAGAGGAACTATCCCATAT
GCAAGTGTAAATGCTCATCTAAAAAAGGACCTTGGGAGAAGAGATGATATGTGGGGCTTC
TTTTATATGATGTTAGAGTTTCTTGAAGAACCTCTTATCTGGAAGTCAAGAATCAAATAT
CGTCAAGTTAAGGAAATTTTTGATTCTTTAATTCGGTTAAAGTATCATTCATAGCCTTAG
TACGATTTTATTAGCAATTACTAATAAAGGCAAATCCTTAATTAAAATACTGGATCCTTC
TTGCCTTAGAACTAGTAATGCTTCTAATTCATGAATTAGGGATAGCAAGGAGTACAAGGA
TTCAATAATTTCTTTATGTAAGATTTCTAAAATTAATCCCAAATTCCTCAATAAAACCTT
CATTAAAACTTGCATGACAAGTAGCCATAAGAGAGCGTCGCTATATAGAACTGCAATAAT
GAAAATATACCAAATAAACGAGAGTAAAAACATCTTGAAAAGCTAATGTAGTAACTTCCA
ATCAGAATGATTTAGTAGAACTCTGGAAATTTTTCTAACTAGTTGTAAAACATGAATTAT
GGAATTATTCCAGATCAGGAACAGAAAATCTCAACTTAAAAGAAGCTCCTTTAAAATTTG
AACATACAGAACAATACCTAATAGTGTGATTAATCGACTAATCCCACTACAAATTAGCTC
TTCGTAAATAACTCTTAGAGCACCTTTGGTTAAAAACTAAGAGATGAGTTGCAATCAGAA
CCTTAGACGCAGGAAGACGATGACCAGAAAAATAGCAATCAATTCTTCTTAAAAGATTAA
GCTAGTTAACATCAAAATGCGGCTAATCTAATTTCTGATAAAGATGAAACTTCAGTTGAA
GAATAGAGTGAGAAGAGATATTAACAAAACAAGTTTTAGCACTAAATTCTTAATCATAAT
TGTCCAACTAATTTGAATGATATAATGGCAGTTCCAAATGTCTTCGATTAACAATAATAA
TATTTTTTCAAGAACTAGTAGCAAGTTAATAATATGCAATAAAATTTCTAAACTACAAGT
AAATAGCAACATTAATAGAATATTTTCAACAACTATTTAAACAATAAACAGCCTTAGCTT
TTGTTAAAATCTGATAATGCCCCAAATAGAAAGAGAGGAAGACCTAAGGGATCTAAAAAC
AAAAGTAAGGGATATTCAAATTAAAATGGTACTTCTATTTCAACCTTAAAAGCCTTTAAG
AATGATCAAAATTGA


>Contig2028.0.g106(protein)
MQSIYQNLPNQLSNNQIEANTILKNRYILKQELGQGSFRQPHIVRTYGFENQEAYNMENF
IVMDLKGINLANYKKQQKIQSELHALDILLQALQAIQDMHQEGIIHRDVKPSNFVMGSRP
EEQEKVFLVDFGLAKDHIDKYTGRPQEARKNIDFRGTIPYASVNAHLKKDLGRRDDMWGF
FYMMLEFLEEPLIWKSRIKYRQVKEIFDSLIRLKYHSQPQYDFISNYQQRQILNQNTGSF
LPQNQQCFQFMNQGQQGVQGFNNFFMQDFQNQSQIPQQNLHQNLHDKQPQESVAIQNCNN
ENIPNKREQKHLEKLMQQLPIRMIQQNSGNFSNQLQNMNYGIIPDQEQKISTQKKLLQNL
NIQNNTQQCDQSTNPTTNQLFVNNSQSTFGQKLRDELQSEPQTQEDDDQKNSNQFFLKDQ
ASQHQNAANLISDKDETSVEEQSEKRYQQNKFQHQILNHNCPTNLNDIMAVPNVFDQQQQ
YFFKNQQQVNNMQQNFQTTSKQQHQQNIFNNYLNNKQPQLLLKSDNAPNRKRGRPKGSKN
KSKGYSNQNGTSISTLKAFKNDQN