Identifiers and Description

Gene Model Identifier

Contig7469.0.g37

Standard Name

ARP8

Aliases

Contig7469_0_g37

Description

Actin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003119805.001531130907917e-44actin related protein
SGDYOR141C1.0003081162615753e-33ARP8 SGDID:S000005667, Chr XV
from 592587-589942, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7469.0.g37(coding)
ATGGCGCTATAATATCTTGATCTTAATGATGAGAGAGATTAAGCTTTGATAAGTTTCCTT
AACCCATATGACCGCGGTTCAGATACTATTATCATCCATCCCGGTTCTCACTCAATTAAG
TTTGGCTTGGCTTCATAGATGCAACCATTCATAATTCCTAATGTCATAGCATATCCTAAT
AAAAATGGGAAGAGGATCAAAGATTTCGAGGGGACTCAGTAGCTCGATGCAGACAGATAG
CAATTATTTGATTAATAAATAGATAGAGTCTTGCCAGAAGTAGAGCAAAGCTTAAGAAAG
AAAAGGTTTTACTTGATTGATGCAAAAAGCGCTAAAAACATCAGAAATAAGCAAGTGAGC
TTCAAATAGTACGATGAGAATAATTGCATTATAGAGGGCCAAGAATTAGACATACCTTTC
GATTCACATAATATGAATGTTATGACATCGGAATTAAATGAAGAACTATGGGGAGAGAAA
TTCAGGTTTACTAGCAGACCAGACACCTAAGACCCAAATACTTAGAAAAGACCTTTCTTT
GTTGGAAAAGAAGCTTTGACATTGCATAAAAATGAAGAATATACATTAAGATACCCAATA
AAATATGGAGACTTTAATATCACAAATACTTAAAACATGCAAGATTGCTGTTAAGATTTA
TAGAACATACTTGAATTTGCATTCAAAAAATACATGGGCTTACCAACTAAAAACATAAAT
TACTTTAACTGTATTCTAATTATTCCTGACATGTTTGTAAGACATCATGTAAGATACATG
ACAAATATGATTTTGGGCAAGATGGAATTCAAAAGTATTTTCATTCATAATGAAAGTATA
ATGTCATCTTATGCTATGGCGTTACCAAGTGCTTGTGTGGTAGATATTGGAAGCACAAAG
ACAAGTGTTTGCTGTATTGATGAAGGATTGATTTTACCAAAAACTTTGATGAGAAAGCAT
TATGGTGGTGATGATGTTGATCAAATATTTTACAGAATGCTTCAGAGACAGAAAGCACTG
CATTATTTCCCCAAAAATATGCTAAATATGGATTCAGTTTTTCATAGATTGCTTATTGCT
TAGATTAAAGAAAGATTTGCAGCTACTGAAATGGATCCTGGTGAAATAGTTAAGATAATT
CACCTTCATATAAAAGATAGAATTGAACCAAAGACATTAAAGAATACAAAAATCACATTT
AATTGTTCAGATGCCTTACTTTTTGCGACTTAAAGTTTGTTTTACGCACCAATGTTAAGC
ATAAATAGACAAATCTTGAGGGATACATCGGACCCTGTACACGGAGATCCTATGATGGTA
GTTTAAGGATTCCAAGACCCTGAAGATATTATGTACGATATCTTGTAAACTTCAAACAAT
GCAGCTTTGTAAAAGCTATAATAGTAACAAAGGGTAGGAGGAGATGATTCAGGGGGGAAT
ACTCCATCAGCAAGTGTTCATCAAGATATGCAATCAGATGTTGGAGACGAATCAGATGTC
GGGGATAAGCAATTTGCTGCAACTTCAATTTATTAACAAATGGATGATCCGATAGATCTG
GACGAAATGATCTGCAGAAGTATTTGCAATGTTGAAAATCAAGAGTTAAGAAGGAAAATG
GCAAACTAAATTATAGTAGTTGGGGGTACAGCGAAAACTAAAAAATTCGTTGACTCATTA
GAAGAAGCTGTTATGGATAGATTCACAAGATCCTTTGATGAGACAATTGAAAGGGTGAAT
GTTGAGCAATTCAATGTCCAATAGTTCCAGTAATTCCAATAGCAACTTATAGTAATGTAA
AGTATGGGACAGGGATAAGATATGACACCAGAGACTCTTAGAATCGATCCTAGATTTGTG
AGCTGGATGGGAGCTTCAATTATTCCAAAACTTGAAACATCAAAAGATTGCTTTATTACA
AGAGAAAAGTACTTAATAGATTTCAAGCCTTATAAGGAAAACTTTTAAGAGGTAAAATTG
ATAGAAATTCAGAAGACAATCGATTAGAAAAACGAACAAGAAGAAAAGAAAGAGAAAGCA
GAAGAAAATACTATGATGATTGATACAATGACTAATAAAATTATTAATCCTGAAGATTAA
AATAAGCTAACTTCAAGTGAAATTGAAGCGATTGAAAAAAATATTGCAGTTAAGCTAAAA
AAAGAAAGAAATATGGAAGCTGGAGTAAAGCATATTAGAGAAAAAGCTCCATTCCATTTT
TGA


>Contig7469.0.g37(protein)
MALQYLDLNDERDQALISFLNPYDRGSDTIIIHPGSHSIKFGLASQMQPFIIPNVIAYPN
KNGKRIKDFEGTQQLDADRQQLFDQQIDRVLPEVEQSLRKKRFYLIDAKSAKNIRNKQVS
FKQYDENNCIIEGQELDIPFDSHNMNVMTSELNEELWGEKFRFTSRPDTQDPNTQKRPFF
VGKEALTLHKNEEYTLRYPIKYGDFNITNTQNMQDCCQDLQNILEFAFKKYMGLPTKNIN
YFNCILIIPDMFVRHHVRYMTNMILGKMEFKSIFIHNESIMSSYAMALPSACVVDIGSTK
TSVCCIDEGLILPKTLMRKHYGGDDVDQIFYRMLQRQKALHYFPKNMLNMDSVFHRLLIA
QIKERFAATEMDPGEIVKIIHLHIKDRIEPKTLKNTKITFNCSDALLFATQSLFYAPMLS
INRQILRDTSDPVHGDPMMVVQGFQDPEDIMYDILQTSNNAALQKLQQQQRVGGDDSGGN
TPSASVHQDMQSDVGDESDVGDKQFAATSIYQQMDDPIDLDEMICRSICNVENQELRRKM
ANQIIVVGGTAKTKKFVDSLEEAVMDRFTRSFDETIERVNVEQFNVQQFQQFQQQLIVMQ
SMGQGQDMTPETLRIDPRFVSWMGASIIPKLETSKDCFITREKYLIDFKPYKENFQEVKL
IEIQKTIDQKNEQEEKKEKAEENTMMIDTMTNKIINPEDQNKLTSSEIEAIEKNIAVKLK
KERNMEAGVKHIREKAPFHF