Identifiers and Description

Gene Model Identifier

Contig14222.0.0.g48

Standard Name

ARP6b

Aliases

Contig14222_0_0_g48

Description

Actin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYFL039C1.0001254448791495e-166ACT1 SGDID:S000001855, Chr VI
from 54377-53260,54696-54...
T. thermophilaTTHERM_001909508.997576389570947e-164actin, identical

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14222.0.0.g48(coding)
ATGGCAGACGAAGAAGTATCAGCAATCGTAATTGATAATGGTTCCTCCCGCCTTCGTATT
GGTTACGCTGGAGATGAAGTGCCAAGATTGACAGTACCAACGCTTATCGGCAGACCAAAA
ATGAATTCAGTGCGTATGGGAATTGAGCAGAAAGAGTTCTATTGTTGTGATGAAGCAGTC
AGCAAAAAAGGCATGCTAAATATGACTAGTCCGATAGAGAAAGGAATCATTAAAGATTGG
GATGATATGGAAAGAATTTGGCAGCATGTACTGAATGAAGAGTTGAAGGCTTAGGTAGAG
GAGCATCCCGTTATTATGACTGAGGCCCCGTTGAATCCTAAGTAGTACAGAGAAAAATTG
ACTCAGTTAATGTTTGAAACATTCAATGTGCCATGCTTATATGTATCAGTTCAAGCAGTA
CTCTCCCTCTATAGTTCAGGAAGAACTTCAGGTCTAGTTTTAGATACAGGAGATACCATA
AGTTTCACAGTACCTATTCATGAAGGTTACGCTATTTCACATGCAACTCAGAAAGTCTCT
CTAGGAGGTAGAGACATTACTAAATACCTAAGTGAATTTGTGGCTCAGTAAAACTTAAAC
TTAAATATGGCTTCAGATGTTGATACACTTAGAGATATTAAGGAAAAACTTTGTTACGTT
GTTAGTAACTATGAAGAATCTTCTTAAGAAGCAGACTAATCTCACGCCTTGGATAAAACT
TACGATTTGCCTGATGGTAGAAAACTGACCCTAGGAAAGCAAAGATTTCAAATTCCAGAG
GCACTATTCAATCCCTCACTCATATCTATGGAATCAGATGGTTTACACAAATACGCTTTT
GATTCAATACTTAAGTGCGATGTTGAAGCCCGCAGAGACCTCTACTAAAACATTATTATA
GCAGGTGGTAATTCACTATTCGAAGGTATGGGGGAGAGACTTTGGTAAGAAATGCATCTA
TTAGCTCCATCTTCACAGAAAATCAAGGTTCTTGCTCCACCGGAGCGTAAGTACTCTGCC
TGGCTGGGTGGAGCCATTTTATCAGCACTCAGCACCTTTCAAACTATGTGGATTAATAAA
TAGGAATATGATGAGAGTGGGCCATCTATCATTCACAGAAAGTGTTTTTGA


>Contig14222.0.0.g48(protein)
MADEEVSAIVIDNGSSRLRIGYAGDEVPRLTVPTLIGRPKMNSVRMGIEQKEFYCCDEAV
SKKGMLNMTSPIEKGIIKDWDDMERIWQHVLNEELKAQVEEHPVIMTEAPLNPKQYREKL
TQLMFETFNVPCLYVSVQAVLSLYSSGRTSGLVLDTGDTISFTVPIHEGYAISHATQKVS
LGGRDITKYLSEFVAQQNLNLNMASDVDTLRDIKEKLCYVVSNYEESSQEADQSHALDKT
YDLPDGRKLTLGKQRFQIPEALFNPSLISMESDGLHKYAFDSILKCDVEARRDLYQNIII
AGGNSLFEGMGERLWQEMHLLAPSSQKIKVLAPPERKYSAWLGGAILSALSTFQTMWINK
QEYDESGPSIIHRKCF