Identifiers and Description

Gene Model Identifier

Contig9419.0.g21

Standard Name

ARP6a

Aliases

Contig9419_0_g21

Description

Actin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010051908.997587713565275e-70Actin family protein
SGDYLR085C5.001531130907917e-44ARP6 SGDID:S000004075, Chr XII
from 301989-300673, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9419.0.g21(coding)
ATGTGCGCGAGTGGTCCAACTTGGAGAGATTCTTTGAGCAAACGTATACTTTTAGATAAC
GGAGCTTATGAAATTAAGTTTTCTGCTGCTTCAGAATTAAAGCCTTCTACTATGTTTAAT
GCAGTGGGAAAAGATAAAAAGTCAAGGGCAGTATACGCAGGTAACAAACTGTTTGAAGAA
CTTGAGAATGGGCATAGCAATATGTAGATTACATATCCTATTATCAGAGGTCTTTTACAT
GATTCAGACTTAGAAACTGTAATTTGGAAGCAAATTTTTTCAAAGTTTAAAAAGCTCGAG
GAAAGAGCAAGTTGCTTGGCAATAACTTTGCCTCCAGTCCTGCCAGATATCGTGTAGAAT
AGATTCGCTGAATTAGTGTTTGAAGATTTCGAATTCGATGCATTATTTATGAGTTCTACT
CATTCCATGATTAGAGAAGCAGCACTTTTGGAGCATCCCTTAAATCTAGGATCAAATTCT
CCAAACCCAAGCCACTAATGTGAATATGTTATAGATTCAGGTTTTTCTTTCACTTATGGA
ATGCCATTTTTCAATGGAAAGCCAATGAAATATGCAGCAACTAGAATTGATGTGGGTGGT
AAATTGCTAACAAATCTACTTAATGAAACTATTTCTTACAAAGAGATAAATCTACAAGGA
GAGACTCATTTAGTCAATGACATTAAGGAGTAATTGTGCTTTGTATCAACATAATTTCAG
AAAGATATGGACATATGCTAGCAACCAGTTAATCCAATAGTAAAGGAATATGTACTCCCT
GATTACAAAACAAACAAGAGAGGTCAAATAAGAGATCCAGTTCCTCAAGTTTCATAACAA
AAATAAGATCAAGACTTTTTCGACTAAATTAATACTAGCAAGTAACATCAGTCTCAAGCT
ATTAGAGTGAACAATGAAAGATTTTCAATTCCAGAAGTCATTTTCACTCCTTCAGATATC
GGTATCAATGAAGCTGGACTTCCAGAAATGATTGCTTAATCTATCTCAAAGTGCCCTTCA
GTTATGGAGAGACAGCTTTATCAAAATGTAATTATAGCTGGAGGCAACACTTTACTTACA
GGTCTCAAGGAACGTTTAGAAAATGATCTACAGCAATATAAACCGGATAACAGCGAGTCC
AAGGTCTATGAACTTACAAGTCCAGTAACTTCAGCGTGGAAAGGATTAAGACATTTCTGC
TAGAATAGGAATAATTTTGAAGAATTTGTAGTCACTAGAAGAGAGTATTAAGAAGAAGGA
TATAGAATACTTAAGAAATTTTATTTATGA


>Contig9419.0.g21(protein)
MCASGPTWRDSLSKRILLDNGAYEIKFSAASELKPSTMFNAVGKDKKSRAVYAGNKLFEE
LENGHSNMQITYPIIRGLLHDSDLETVIWKQIFSKFKKLEERASCLAITLPPVLPDIVQN
RFAELVFEDFEFDALFMSSTHSMIREAALLEHPLNLGSNSPNPSHQCEYVIDSGFSFTYG
MPFFNGKPMKYAATRIDVGGKLLTNLLNETISYKEINLQGETHLVNDIKEQLCFVSTQFQ
KDMDICQQPVNPIVKEYVLPDYKTNKRGQIRDPVPQVSQQKQDQDFFDQINTSKQHQSQA
IRVNNERFSIPEVIFTPSDIGINEAGLPEMIAQSISKCPSVMERQLYQNVIIAGGNTLLT
GLKERLENDLQQYKPDNSESKVYELTSPVTSAWKGLRHFCQNRNNFEEFVVTRREYQEEG
YRILKKFYL