Identifiers and Description

Gene Model Identifier

Contig19647.0.g16

Standard Name

ARP5

Aliases

Contig19647_0_g16

Description

Actin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001334703.9985196551577655e-99Actin family protein
SGDYNL059C5.001742359316081e-68ARP5 SGDID:S000005004, Chr XIV
from 514935-512668, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19647.0.g16(coding)
ATGCTGTTTTACAAACCCGAAAAATATCTACTGCCTTAAAGTGGGCATGAGCCAGCACCA
TTTTCAAGGCATTCTCAATACACAATGGCTTCTTCAATAAAAGCTGATCAAGATCCAACT
AGAGGAGCAGCTGGAGACCCCTATAAACCCCCTGTTCGATACGCCGATATAATAAAGCAA
AAGCCAATTGATCAACCACCTCCCAGATTTATTCGAGATCAAATTGCAGTCGATGACATT
AATGGCACAAGACCTAGAAGTATTTACAGAGGTGTTGCTAAAGATATTATCAGCACTAAA
GACATAGATGGAACGTCACCTAAATATGAGAAGATGAAACCGAAAGCATATGATTTAATG
GATGTTTCCGATGTTAATTAAAAAAAGAAGCATTACCAATCAATGAGAGACCCTCTAAAC
CCAGTATACATCTATTAATAAAAGGGATTAAATAATGACATGCAAAATATGCATGGGACT
AACATGCTCAGGTATGGAGAGATTGAGGGAGCGAGGCCGAAAGTTATGGTAAAAGACTAT
TAAGAAATGCTTAATAAAAAAATTGAACCTACTTGGTTAACCAATTAGAAATACGCAATG
CTTAGACCAGAGCCTTAGAAGAGTTTCGATATGACAATGAATTCTATGAATAATGGCCGT
CTCTCCCCAGATTAAATGAGCGTGAAATCCATTTATAGACCTAAGATAGATGTGTCTCCA
GAGAAGTATGATTATTACGGAAACGCTATACCAAATAAAGATGTCATGAAAGTTGATGAC
ATATAGGGTGCCCACTCTGGAAGCTTGCACAAAACTACTATGAGAGAGAATAATCGCTAA
GTTAACCCATTAGAACCCAGCTACAACTACCCTGGAGGTCGGGAATTACAATCCCAAATA
GACTTATATAACTCCATGAAATCACAATATGCAAATAAAAATAATCAAATTAATTAACCA
TTCGCTCAGCCAAATGCTGGCTAATAGAATAATGACAGTGTATTTATGAGGTCATCCCTA
AATACCATTCATGGAGATAAATATAGCGAGTTGCCAATAGGGAAATCAGTATCTGTCAAA
GATTCCATAGACAAATATTAAGACATTCTAAAACCATATAAATACAAGCATACTCAAGAT
AGACCAACTATAGTAATCGATAATGGAAGCTATGAATGTAGAGCTGGGTGGTCTTTTGAT
GACGAGCCATATTTGAGATTCAGAAATTAAGTTGCCAAGCCCAAGACTTCAGTTAACAAG
GCGATTGACGCCATGCATTTAGTTGGAGATGAGATTAACGAATTTGATGCTGGGAAGATT
CATAAGAGATCCATGTTTGATAAGAATATCGTATATCATGTGCAAAGTTTGGAACACACA
CTTGACTACACATTTGGACATTTAGGTCTAAGCCAAGAATCCTCAATTGAATATCCCGTG
TTAATGACTGAACCAATGTGCAACCCTAACTATTGCAGATCAAACATTTCAGAACTCTTA
TTTGAATGCTATAGAACTTCAGCTGTATCATATGCAGTAGATTCAATTTTAAGTTACTAT
TACAATAGAGCTACATCACTCAAAGATGACTTCTCTATTGATAAATCAAATGGTTTAATC
ATTTCAAGTTCTTACAATACTTCACATGTTATCCCAATTTTAGATGGTGGAGTAATGTTA
CAACAGACTAAGAGACTACCACTGGGTGGCCAGCATCATCTTGAACTTCTGAATAAAAGT
TTGAACCTGAAATATGTGCAACATAAGAACAACTTAAGCATTGAAGGAATTTAGTATATT
TAAGAGAATCACACTCACTGCGCTTCTAACTATAGGGATCAGATTTTATTCTTGGAATCA
GTATATTAGGATGAAAGAAATTACTAAAAAGAGGAGGAACGTAAAAGATAGGAAGCACTC
TATGGAAACGTTAATAACCCCTAAGAAGGCAAATCATTATTGAAGATAGACGCAAAAGAC
ACGTAGATAGGGAGAAAGTTGATTATATATAAAGGCAGAACTTAAAAGCTGAATGATGAG
CTTGCCGAAGATGAAGGCATTGATAAGGAAGATCATGTAATTTAACTACCTTGGGTATTG
GAAGCAGCTCCGACAGATGATGAACTTAAGAGAAGACACGATATGCGCAAGGAACAGGGT
TAAAAACTAAAGGAAATTATGCAAAGAAAGCGTGAAGAGAAGAAACGTAAGATGGAGGAA
GAGCTCACTGATTTGTTATCACTTGAGACTTATAAAGAGTAAAATGACATGGCTAGTTTT
AAGGAAGAATTACAGCATAGAAGCATAAGTTCAGTAAATGAATATACAAAGCGAGTCAAA
TATCTCTAAGTCAAGCTCAATATCAAATAAACAGAGGGAAAAACAGACGAAGAGAAGTAT
AACTTGATTGATGTGCAGGATGAGTTTCTAACTCCAGATTAACTTAAGCAGAAAAGAATT
TAGAAAATGCAAAAGACTGCAACTTTAATGAGGGAGGAGAAGAAAGCTCAAATGAGATCA
GAGAGAGAATAGATTGAGAAAATTAAGCAGTCCGACCCAAACTCTTACATAAAGTCATTA
TATGACAAGAGAAAAGAAATTCTCGATAGAATGAGTGAGAGAGCTAGAAGAAAGGAGGAG
TTTTCCAAAAGAGGTTCTAAGGCAGCACAGAAAAGAATGTAAATGATTGCTGAATTGGGA
ATAGATGATGAATCGCTACAAAAGAAAAGAGGAAGACCTCCAGCTGAAGTTAAAGACTAA
AATAAGGATTAAGACAATGATGATTTCGGAGCAGCTGATGAAGATTGGGATGTCTACAGA
GGCATTTAGAAGGATGGCTATTCTGAAGACGAAGAAGACGATCAATAAGCTCTGAATGAA
TTAGAGGAATAAATTGCAGAACTAGATCCTAAATTTTCAAATTTACTGTATAACACTAGC
GCCCAGCCTACTGCTGAAGATTATTAAATTAGACTTTGGAGTGATAGATACAGAGGCACA
GAAATAATTTTCCAGCCATCAATTGTTGGCCTTGAAAATGCAGGACTAGCTGAGATCCTA
GAAAATATAATGAGCTCTCTAACTTAAGACCAAAAGAATAACATGCTTCAATATGTACTC
TTAACAGGTGGTCATACTTAAGTACCAGGTTTTGACAAGAGAATTAAAGCTGAATTAACA
ATGATAAATAAAGTAGGAACTCCAATTAATGTTGTAAAGTCTTACGATGCTTAATTAGAT
GCGTGGAGAGGTGGAGTGTGGCTTTCAAGAAATCATTTCAGTGGGCAATAATTACAAGAT
TTCACAATAACTAAAGCTTAATACGATGAATGCGGACATCACTACTTAAAAGAACATTTT
TGCTCAAATGTGCTCTATGGAAGTGTGCCATCTAAATACACATCAAATGTTAAAAAAGCA
TAGCCAAACACCCTTGATTAAGTTAACAAAAGATTAAAAGTATGA


>Contig19647.0.g16(protein)
MLFYKPEKYLLPQSGHEPAPFSRHSQYTMASSIKADQDPTRGAAGDPYKPPVRYADIIKQ
KPIDQPPPRFIRDQIAVDDINGTRPRSIYRGVAKDIISTKDIDGTSPKYEKMKPKAYDLM
DVSDVNQKKKHYQSMRDPLNPVYIYQQKGLNNDMQNMHGTNMLRYGEIEGARPKVMVKDY
QEMLNKKIEPTWLTNQKYAMLRPEPQKSFDMTMNSMNNGRLSPDQMSVKSIYRPKIDVSP
EKYDYYGNAIPNKDVMKVDDIQGAHSGSLHKTTMRENNRQVNPLEPSYNYPGGRELQSQI
DLYNSMKSQYANKNNQINQPFAQPNAGQQNNDSVFMRSSLNTIHGDKYSELPIGKSVSVK
DSIDKYQDILKPYKYKHTQDRPTIVIDNGSYECRAGWSFDDEPYLRFRNQVAKPKTSVNK
AIDAMHLVGDEINEFDAGKIHKRSMFDKNIVYHVQSLEHTLDYTFGHLGLSQESSIEYPV
LMTEPMCNPNYCRSNISELLFECYRTSAVSYAVDSILSYYYNRATSLKDDFSIDKSNGLI
ISSSYNTSHVIPILDGGVMLQQTKRLPLGGQHHLELLNKSLNLKYVQHKNNLSIEGIQYI
QENHTHCASNYRDQILFLESVYQDERNYQKEEERKRQEALYGNVNNPQEGKSLLKIDAKD
TQIGRKLIIYKGRTQKLNDELAEDEGIDKEDHVIQLPWVLEAAPTDDELKRRHDMRKEQG
QKLKEIMQRKREEKKRKMEEELTDLLSLETYKEQNDMASFKEELQHRSISSVNEYTKRVK
YLQVKLNIKQTEGKTDEEKYNLIDVQDEFLTPDQLKQKRIQKMQKTATLMREEKKAQMRS
EREQIEKIKQSDPNSYIKSLYDKRKEILDRMSERARRKEEFSKRGSKAAQKRMQMIAELG
IDDESLQKKRGRPPAEVKDQNKDQDNDDFGAADEDWDVYRGIQKDGYSEDEEDDQQALNE
LEEQIAELDPKFSNLLYNTSAQPTAEDYQIRLWSDRYRGTEIIFQPSIVGLENAGLAEIL
ENIMSSLTQDQKNNMLQYVLLTGGHTQVPGFDKRIKAELTMINKVGTPINVVKSYDAQLD
AWRGGVWLSRNHFSGQQLQDFTITKAQYDECGHHYLKEHFCSNVLYGSVPSKYTSNVKKA
QPNTLDQVNKRLKV