Identifiers and Description

Gene Model Identifier

Contig3933.0.g99

Standard Name

ARP4

Aliases

Contig3933_0_g99

Description

Actin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009753801.9998944264638884e-101Actin family protein
SGDYFL039C9.998819815181669e-76ACT1 SGDID:S000001855, Chr VI
from 54377-53260,54696-54...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3933.0.g99(coding)
ATGTATTGCGGAGACGACGTTTCAAGTTGTGTGATCGATATTGGATCATTTCAAACAAGA
GCAGGCTACTCTGGTGAAGATTGCCCAAGAAGCGTGATTCCATCTTATGCTGGCATATTA
GATGGACATGTATCTGAAGAGGATGTTGACATGGCAGATGTTGGAGTTGAGCAATAGAAA
TAATCAAGGAAATATATAGTGGGTTCAGCTGAGCTAAACTATAAAAGAGATAATATGGAA
ATTCAACCTCTATTTTCCGAAGCAGGCATAATCAACTTTGATTTCTTAGAGGATATCTTG
AATAAGAGTCTGATTGATAATTTGATGATAAATCCCAAGGAAACTCCATTACTTTTTACA
GAGACAGCTTTGCACAATAAGGAAGCCAGAATAAAGCTTACAGAGTTCATGTTTGAAAAG
TATCAAGTCCCAGCAATCTTTATAGGCAAAGCACCAGTCCTAGCTTCATTTTCTTGCGGT
AGATCAACTGCGATAATTGTTGATTCTGGAAGCAAAACTACTTATGCAACCCCTGTACAT
GATGGTTATGCTCTGCAAAAATGCATCATTAAGTACGATATTGGAGGTCAAACTCTAACT
AACGACTTAATGAATTGGCTTGAGAATGATAAGAGAATTGAAGTCCTCCCAAGATTTGCA
TTCAAAAAGAAATTCTAAAACATAAACGGAGTAGAGACATTTGAGACCACAAGAGTTGAC
ACCAATCTTGTGCATCCATCTTACATGCAATGGTCAAAAGAAGAAATTGTTAGAGATCTT
AAGGAAGAAATGTTCTACGTAAGTGAAGATTAAATTGATGATAGAAGCTTGGAGACTATT
AAAACTTTGAACTATGAGTTACCTGATGGAAATCAAATTAGCTTGCAAGGTGAGAGAGTC
TCTTTCACAGAGAAGATGTTCGTACCTAATGAAAAATTACCTGGCTTTACTGGTATCTAA
CACATGATCGTAGAATCTATTGGCAAATCAGATATTGATATCAGAAGAGATCTCTTCCAA
AACGTAATTCTCTCAGGAGGCAATACTCTCTTCAAAGGGTTCTTAGAAAGACTGCAAAGA
CAAATTCCAGAAATCTCTCCTTAAAATGTCAAAGTAAAGGTCATAAGCAGTAACGAAAGA
AAATTCTCATCTTGGGTTGGAGGTTCTATTCTAAGTTCATTGGGATCATTTTAACAAATG
TGGATGAGCAGACAAGAATATGAGGAGCATGGCTCAATTATGATTGAAAGAAAATCAATT
GTTATTTCTTCACTTGTTGCTCCAATCACTCAATCCTAAGATCATCATGATGAGAGAAAT
CAGTATGGATTAAAATAGAGCTTTGATTATCTAGCAAAAGTTGCTAGATCAAATTCATGT
ATGAAAGACCTAGTTTAAAACTTATCAGAAAATTGCTTAAATCTCGATGAAAATCATTAA
TCTAAGATTGCTTTTGGTTTGATGAATTGTCACCTCATGATATCTGGTAAAGAAAAAGTA
AGATGTGAAAACAAAGAACTCAAATAATGTTTATCAAAACTCGAAGGAGATAAGTGGAAC
TCTTACAGTCTATTTTTTACTCACACTTAACAAACTTGTTACTATTTGAAATAAGAAGCT
TGGTAAGAGAACACACAAAATTTGATTGAGGGTCTTGATTAGTCATCACATCTAGCTCAC
GAAAGATTGTTGAGATTAATAGATGGTCAAACAGTATTAGACTCAAGTTTGCAAGAAACT
TATAGAATCACCTAAGACACTTTTTCTGAGCTTTAAGTTTAATAAAGTATGTAGAAATAG
CTTTAAAGTAGTATGAATGAGATTGGTGATTCTTTGACAACAAACTAAGAGAAACTCAAT
GCCTTTTTTCATTCGATTACTTCAAAGATTGACATTATCTATCAATTTCAAGCTCTGTTG
ATAGTTCTACTTTTCAACTTCATGGAATATAATAATTACATGAAGCTTCTAAACTACTAT
CGAGGTCTCTGTATTTTGATTATTGGCTTTCAAATGAGATTCTACAAAGCAAAGTTTGTG
AATTATAAGGTGGAAAATAACAAACTTCTTAAAAGAGTTGTTGAGTAGAGTGTAGATTAG
ACACCAGGTTGGTTCAGAAAATACAAATCGTCCTTCCTGCTAGATTAACAAAAGCATTAA
TCTAATAGACACTCTAACTAATCTAATTTTGGATCTAATGAAGCAAGGAGGCTTTTTTAA
GATTCAATACCTTAAATGTGTTAAAGCAAACCTTTCCTTTCATCAAAATAAAAAATCGAT
AACTTAAGTATTTATGATTAAAGTTATGAAAGCTTGTCAACTAAGTCTAGCGTTGCAGCT
TAAACAAACTCTATAAGAGATCCTAATCATCCCAGGTTTTAATAAATGCCAACACATGCA
TTTAACTCCCTTATGAGAAATGACAGAGCATAAATACAATCAAAGTAAAGACTATAGACA
ATAAAGAAAAGTGAAAGTATTTGCAACATGTAAGATTAAATGAATTTTCAGACACCTGAT
CATAGCTTGAGTTTCAAAAAGTACTCCCGCATTCAATTTCAGTCTGCTTGA


>Contig3933.0.g99(protein)
MYCGDDVSSCVIDIGSFQTRAGYSGEDCPRSVIPSYAGILDGHVSEEDVDMADVGVEQQK
QSRKYIVGSAELNYKRDNMEIQPLFSEAGIINFDFLEDILNKSLIDNLMINPKETPLLFT
ETALHNKEARIKLTEFMFEKYQVPAIFIGKAPVLASFSCGRSTAIIVDSGSKTTYATPVH
DGYALQKCIIKYDIGGQTLTNDLMNWLENDKRIEVLPRFAFKKKFQNINGVETFETTRVD
TNLVHPSYMQWSKEEIVRDLKEEMFYVSEDQIDDRSLETIKTLNYELPDGNQISLQGERV
SFTEKMFVPNEKLPGFTGIQHMIVESIGKSDIDIRRDLFQNVILSGGNTLFKGFLERLQR
QIPEISPQNVKVKVISSNERKFSSWVGGSILSSLGSFQQMWMSRQEYEEHGSIMIERKSI
VISSLVAPITQSQDHHDERNQYGLKQSFDYLAKVARSNSCMKDLVQNLSENCLNLDENHQ
SKIAFGLMNCHLMISGKEKVRCENKELKQCLSKLEGDKWNSYSLFFTHTQQTCYYLKQEA
WQENTQNLIEGLDQSSHLAHERLLRLIDGQTVLDSSLQETYRITQDTFSELQVQQSMQKQ
LQSSMNEIGDSLTTNQEKLNAFFHSITSKIDIIYQFQALLIVLLFNFMEYNNYMKLLNYY
RGLCILIIGFQMRFYKAKFVNYKVENNKLLKRVVEQSVDQTPGWFRKYKSSFLLDQQKHQ
SNRHSNQSNFGSNEARRLFQDSIPQMCQSKPFLSSKQKIDNLSIYDQSYESLSTKSSVAA
QTNSIRDPNHPRFQQMPTHAFNSLMRNDRAQIQSKQRLQTIKKSESICNMQDQMNFQTPD
HSLSFKKYSRIQFQSA