Identifiers and Description

Gene Model Identifier

Contig18340.0.g84

Standard Name

ARID5b

Aliases

Contig18340_0_g84

Description

SET domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005786607.9993595954329e-16conserved hypothetical protein
SGDYPL165C0.0000009995106777214876SET6 SGDID:S000006086, Chr XVI
from 239077-237956, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18340.0.g84(coding)
ATGGAGTCCGCAATTTAAAGTTAAGTTTCAGATAAAGAAATCCCTTAAGATGACCCTGGA
AATGTATTTAACAAAATTATATCAGATGTTTCGAAGGAAGATTTTGATAGGGTAGTGAGA
TAGTTTAGGATTCTAGAAAACTAATTTAGTGAATTACTCGATACTTTCTCTGAAGATTTT
TATAAACCACCGACTTCTAATGCAAATTCTTAATCACTGAGCACACTTTTAAATACAGAT
AACCAATATTTCAAGCCAACTTATGACGAATAGACAGTGTTAAGCTAGGATAATGTCTAT
AAATATTGCAGTAATTGCTTCAAGACAAGTTCAACTTTAAAATAATGCTCGTAGTGTAAA
TTTACACATTACTGTCAATAGTCTTGTTAAAAAGATCACTGGGCAACTCATAGATCAGAA
TGCAAATCCCCAAAAAGTGCAATATCTTTAAAGTCGATGCCTCAATCACTGAGATTGCTA
CTTTCACTACTTTACCTTAAAACTGATAGTAAAAACCCTAAATTCATGAGCAATTTACAG
ATTTTTAATGAATAAGTTATCACTATGATAAGTAATGCTTCCAAGATATTAATGAAGAGC
TAGGAAAAGCGTGAAGAAGTAATGAACTATGCAATGGTATGTTTCTTAAAAACAGCATAA
TCTAGTAATTTTGAAGTAAACATAGACAATTTCAAGTTAATTGTGCATTTGTACTTTTTG
AGTATTTGCAATGGATTTGGCATTGCTGATAATCAAATGTTAAGGATTGGCACAGGGCTC
TATTATCCATCAAACTTATTGAATCACTCATGTGACCCAAATTGCATGGTTTTGTTTAGA
GGCTAAACTTAATTTATTGTTACCTGCCGACCTATCGAGGCTGATGAGGAAATAACTATC
TGCTATATTGATAATGGGATATCTGAGAGAATAATTAGATAGTAATACTTGCAGGAATAA
TACCATTTCAATTGTATGTGTGCCAGGTGTCTTAAATAGATAGGAGAAGGCACTGAGCTA
AAAGAATAAAAAGTGTAAATCTAATTCTCAGAAGAGCAGTAAATTCTAAATAAACAAGCT
CTCCATGAAGAATCTTTAGGCAATTTTGACAAAAGTTTAAGTCAACTCTCTCAACTCTAT
AAGTCAGTTGAGACTAATAAATCCACCTAAATTTTTCAGAATTCTATGATTAAAGAACTA
CTAGAGCGATTAGTTTATCTATCTGTGATGAATAAAGACTACAAGTTTGCAGTAAAGTTT
CAATAAAAACTAGTAGATTTATGTGAGATAATGTATATTAAGGAAGTTAAGAGAGAAGAT
GAACTCCCGCATCCATTAATAGCCTTGCACTATTATTAATTGGGCAAGCTTTTATCATAG
CGCAAGAAGTATCAAGAAGCTATTGATAATTTATAGAAAGCTATGACATTAGTGAGCGCA
TATTATGGCCTAAAATCATCAAAAGACGGTAAAATGATTGATGAAAAGCTTGTGCATGAA
GTCAATGAAAATTATTTGGCAAATTGCTAAAAATTACAATCCAGTAAGAATTGA


>Contig18340.0.g84(protein)
MESAIQSQVSDKEIPQDDPGNVFNKIISDVSKEDFDRVVRQFRILENQFSELLDTFSEDF
YKPPTSNANSQSLSTLLNTDNQYFKPTYDEQTVLSQDNVYKYCSNCFKTSSTLKQCSQCK
FTHYCQQSCQKDHWATHRSECKSPKSAISLKSMPQSLRLLLSLLYLKTDSKNPKFMSNLQ
IFNEQVITMISNASKILMKSQEKREEVMNYAMVCFLKTAQSSNFEVNIDNFKLIVHLYFL
SICNGFGIADNQMLRIGTGLYYPSNLLNHSCDPNCMVLFRGQTQFIVTCRPIEADEEITI
CYIDNGISERIIRQQYLQEQYHFNCMCARCLKQIGEGTELKEQKVQIQFSEEQQILNKQA
LHEESLGNFDKSLSQLSQLYKSVETNKSTQIFQNSMIKELLERLVYLSVMNKDYKFAVKF
QQKLVDLCEIMYIKEVKREDELPHPLIALHYYQLGKLLSQRKKYQEAIDNLQKAMTLVSA
YYGLKSSKDGKMIDEKLVHEVNENYLANCQKLQSSKN