Identifiers and Description

Gene Model Identifier

Contig1044.0.g66

Standard Name

ARID5a

Aliases

Contig1044_0_g66

Description

ARID/BRIGHT DNA binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam01388 ) ARID/BRIGHT DNA binding domain
  • ( pfam12031 ) Domain of unknown function (DUF3518)
  • ( pfam04063 ) Domain of unknown function (DUF383)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002439008.002420766648515e-44ARID/BRIGHT DNA binding domain
containing pro...
SGDYMR176W0.00007000107212225429ECM5 SGDID:S000004788, Chr XII
I from 611740-615975, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1044.0.g66(coding)
ATGGGATTTTAGATGCCAAAGAACCTGGAGTTCCTTGATGAAGAAGACGAAAAGAAAAAA
TGTCAAGAATTCAAGGACCACCTCATAAAATTCTAAAGAGAGCTTGGTGTGGAAAACTTC
AAAGTTCCATCAATCGGAGGGAAAGAGTTGGATCTTTGCAAACTTTATAAAGCAGTGATT
CAAAGAGGCGGCAGCTAGAGAGTTTCCAATAACAAACTCTGGAAGGAAATCGTCAATGAG
TTTGAGATTCCCTCAAGCTGTACTAGTGCAAGCTTTACATTGAGAAATCACTATAACAAG
TGCCTGCTTCAATATGAAAAGAAATATTTCTTGGGTCATTCAAACTTGGATATTGATGTC
AGAAATGGAGGGGACATGCTTCCACCTAATATGGTTGGATCAGCGGCTCAAAATATGAAT
CAATTCTACCCACCAATGTATCCTCCTTAAGCGCCAAATCAATTTGCTATTCCACCAAGC
TACGGTTAGACTATCATAGGTGGCTCTGGTTACAGTGCCTCTGCTCACAATTTCATTTCC
TAAGGTCCCTAGATATCTAATGTGGGAAGACCAGGGAAAAATGCCTATGATCATCAAGGC
TTTCAAAGCTAATAGCAAGCTCAACAATCTCTACAATCTCAGCCAGCCTCTGTAAATTTG
AATTCCAAGTACTAGATAACTAAGAAAGTAAAACTCTCATAGATTGAGGCAGAGTCTAAG
AGGTTAGTGCTTGCTTTTGAGTCAAGAATCACCAAAGAAATTAACTGGGCTTTGAATACT
TTGACTATCTTCTCCTGTAATACAAACTAAAACTTCACATTGGAAAATCAGCCATATTTG
CTTGAGAGTATTTCAAACTATCTTGTCTATTGCATTCAAAACATCGAAAGTTTAAGTTAC
TCTGATCCTTTCGAGAAAAAGAGCAAGATTCTTTCAGTTAATGTTCCTTCTTACGTGGAT
GTCTTAATGTCCGGGTAAAGCAATATGCAATCACTTGGTGATCACTAAAATATCTCGTAA
CATCAACAGTTTGGCATGCAAAAGCTAGATTACAAGAATTTTGGTTAGTTCACAAAGGAA
ATAAGAAAGAGAGAAGGAAAGTACGAGGAGAAGAAGAAAGAATTGATTGATGAGTTTGTT
GCCTAATAGCAAATAGGAAGTGGAAACGCTCTTTCAAGCAACATGCCAAAAGCTAGAGGT
AGAAAGCCAAAAATTAAGATCTTAGAAGAGTAGAATGCTCTTGATGAGTTGAGAAAGAAA
AGAAAGAAGTTAGTTACTGTACTTCACTAAGAAGTGACAGAGCTTGAACTTATTGATCAC
TTGAGAATGATCATATTGATTGTGAGAAATTTGTCTTTCATTAGAGCAAATGAGCACCAC
TTGATCAAGTGCTTCAAACTTCTTGACATCGTCACATCTTTGTTTGTGGACTTAATTGAC
AGAGAAATTACCTTTAATTGCTTAGATATCATCACAAATCTTGGAAAACATTTAGTGCTG
AGTGAGCTTAACTGTGGAAGAGAATTAGTAGATGCTCTGTTTGGACTATTCAGCACTGCT
GATTCAGAGTTGATTGTAGACTAGTGTGTGGAATGTTTGAGAAGACTCAGTCTTTCAGCC
GGCAACGAAGAATACTTGGAGGAAGTAAGAGATGAAGACATTCAAAATTTGATAAACTTA
CTAATGAGCAATAATATCGAGACTAGAGAAGGATGTTTAGAAATTCTATGTACCATTAGT
GATAGAAAGACTACCCTCAAGGTCAAAATTGCTCATCAAAAGAAATGTATAGAAAGACTG
ATTGGACTCATTGCGACAGGATCTCAGACCCCAAATGAGGAGAAGATATCAAAACTAGCT
GCACTTACCTTAGCCAACTTGAATTTAGCCCCATCTAACAGAGCTTTGATCGTGCCCTAT
GAACAAGAACTTGCATTGATTGCTGCTTCAGATGAAAAGACTTGCAAAATTATTGCTGAA
ATTTTAGGAGACTTAGATTCCTATCAAGTTTACTCTAAGTGA


>Contig1044.0.g66(protein)
MGFQMPKNLEFLDEEDEKKKCQEFKDHLIKFQRELGVENFKVPSIGGKELDLCKLYKAVI
QRGGSQRVSNNKLWKEIVNEFEIPSSCTSASFTLRNHYNKCLLQYEKKYFLGHSNLDIDV
RNGGDMLPPNMVGSAAQNMNQFYPPMYPPQAPNQFAIPPSYGQTIIGGSGYSASAHNFIS
QGPQISNVGRPGKNAYDHQGFQSQQQAQQSLQSQPASVNLNSKYQITKKVKLSQIEAESK
RLVLAFESRITKEINWALNTLTIFSCNTNQNFTLENQPYLLESISNYLVYCIQNIESLSY
SDPFEKKSKILSVNVPSYVDVLMSGQSNMQSLGDHQNISQHQQFGMQKLDYKNFGQFTKE
IRKREGKYEEKKKELIDEFVAQQQIGSGNALSSNMPKARGRKPKIKILEEQNALDELRKK
RKKLVTVLHQEVTELELIDHLRMIILIVRNLSFIRANEHHLIKCFKLLDIVTSLFVDLID
REITFNCLDIITNLGKHLVLSELNCGRELVDALFGLFSTADSELIVDQCVECLRRLSLSA
GNEEYLEEVRDEDIQNLINLLMSNNIETREGCLEILCTISDRKTTLKVKIAHQKKCIERL
IGLIATGSQTPNEEKISKLAALTLANLNLAPSNRALIVPYEQELALIAASDEKTCKIIAE
ILGDLDSYQVYSK