Identifiers and Description

Gene Model Identifier

Contig21006.0.0.g94

Standard Name

ARFL1

Aliases

Contig21006_0_0_g94

Description

The ARF-like 2 binding protein BART

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003709104.9985000769285e-31conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21006.0.0.g94(coding)
ATGTCTGAGGAAGAAATACGTGATTTGGAGTTGTTAGTTGACCCTCATTCCCTAGGTAGT
TTTTCTGATTAGAAATTGGTCAATGCTCTCACAAATTTAATGACAAAATACGATGAGAAT
GAAATGCAAAGATCACTTCAGACTCTGGATAGAGATCAAGACGGAAAGATAAGCATGGAA
GAATTTGACTATTTTATGAATGAATATGGAGATAAACTATAACACTTTGAGAAAAAGATC
CTCTTTTAAGAATTGATACAACCAACTGACCACTTGGATTAAAGTCATAACAACGTTCAA
GACGCAGCAGATTTGCTCAGATAAATGGATATAGACGGTCAAAATGAGAACTTTATAGAT
ATTGTTGATGGTGATGGAATGGAAGACGATGAAGATTTTGAATTTTCAGCATAAGGTGGT
AACAACGAGGATGATGAATTTGATCAAACTGTTGGAGTTCTTCAAGAAATCTTGTTAGAT
TCAAATTTCGAGCAATTGCAAAAGAAATTCTGCTAACAAAATTGCATGCATTTTGAAGCC
ACTGAAGAGAACAAGTTGATCTACACTGATATATTTTAGAGATACTAAGAACAGATTGAG
AAATTTATTGAGGATAAATTGAATCAAGCAATTGAAGGGTTCAGCATGGAGAGATTTCTT
TAGTAAGTTGAGGAAAGAAAGGACGAGATAGATGAGCAGATTATGGATACATTACTAAGC
TGTGTCGATTTTGATTCCTTCAAAGAGCTCATGCTCTTCAGTAGAGCACATTTAGTAGCC
ACTACTCCTAAACTTAAGAGTGGGAAAGCTTCTGCATTAGGATTGAAAGATAGCAAATAA
TTGGCTCAACCTTAAGCTTCCACTTTTGGCTCTGAAGGTTCAAATAAGCTCTAGGAGCAT
GACTTGAAGCACTTTGAAGAAGTTATTGATAAATTGGCAATTAGCGGATATCAAAAGCAG
TTTCACAAGGATGAAGATAATGATGGAGACGAGAGACCAGATCTCAATTTATTCATTACT
AAAATATGA


>Contig21006.0.0.g94(protein)
MSEEEIRDLELLVDPHSLGSFSDQKLVNALTNLMTKYDENEMQRSLQTLDRDQDGKISME
EFDYFMNEYGDKLQHFEKKILFQELIQPTDHLDQSHNNVQDAADLLRQMDIDGQNENFID
IVDGDGMEDDEDFEFSAQGGNNEDDEFDQTVGVLQEILLDSNFEQLQKKFCQQNCMHFEA
TEENKLIYTDIFQRYQEQIEKFIEDKLNQAIEGFSMERFLQQVEERKDEIDEQIMDTLLS
CVDFDSFKELMLFSRAHLVATTPKLKSGKASALGLKDSKQLAQPQASTFGSEGSNKLQEH
DLKHFEEVIDKLAISGYQKQFHKDEDNDGDERPDLNLFITKI