Identifiers and Description

Gene Model Identifier

Contig11389.0.g111

Standard Name

ARFF1

Aliases

Contig11389_0_g111

Description

ADP-ribosylation factor family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007352407.997402223525235e-19small GTP-binding protein doma
in containing p...
SGDYDL192W8.000721090200152e-18ARF1 SGDID:S000002351, Chr IV
from 116321-116866, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11389.0.g111(coding)
ATGGGAGTATTCGGTTCAAAGTCTTAACAGAAATAAATTCTACTGACTGGTCCAGAAGGC
GCAGGGAAGACAACTCTACTTTATTCTATGATTTTAAGGAAGAAGGAATGGAGGGCTACA
CCCACCACTGGATTTAATTATGAAGAGATTTAGAGTGAGAGAGGCGACAGAGCAGGGGTA
TGGGATGTAGGTGGATCATTAACTACATAAATGATTATGTCATCAATCTATAAAAACGTG
CATTTCAGTGGATTACTGTATGTGATAAATATTGATGACCCAGAGCACGTAAACATAGCC
AGGAAGGAACTATAGAGACTGCTTAATGAGGATGAACTTAGGCATATATAAATTCTAGGA
TTAGCATTGTGCTTTAAGACTTATGGAAGTATGAATGCAGGAAGTAACTCTAATAAACAA
TTACAAATGAACAATCTTTAGGGTTAAGAGGGCTATAACTAAAATAAAGTTTAAGATAAA
AGAGAAATGACTCAAGATTAAAGATTAAAGCGAAAGAAGCAGTTGCATGAAGACCTGGAT
TTAGAGAGCTTAAACAAAAAAATTACAATAATAAGTGAAATATTTGATGTAGTGTAGGAA
AAAGAAGAACGTGTTCAATTTATTGATAATGTACTCAAAAGTGTCAATGAATAGGGGAGA
TGA


>Contig11389.0.g111(protein)
MGVFGSKSQQKQILLTGPEGAGKTTLLYSMILRKKEWRATPTTGFNYEEIQSERGDRAGV
WDVGGSLTTQMIMSSIYKNVHFSGLLYVINIDDPEHVNIARKELQRLLNEDELRHIQILG
LALCFKTYGSMNAGSNSNKQLQMNNLQGQEGYNQNKVQDKREMTQDQRLKRKKQLHEDLD
LESLNKKITIISEIFDVVQEKEERVQFIDNVLKSVNEQGR