Identifiers and Description

Gene Model Identifier

Contig2692.0.g56

Standard Name

AQR

Aliases

Contig2692_0_g56

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004977900.0000020007268868677913S-antigen protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2692.0.g56(coding)
ATGTCAACCAAAGCGAATACTAATGCTTAATAGCAAGACTTTCAAAAACCTGATAATGTT
GAAATGAAAGAATTAAATCAATTTTCAACTCCAGCATTCTATTAAGAAGTTGATCTTTAG
CTTTTGTACGGGCATTTATATGATAATCATTAAAATCTAACAAGAAAATAATAAAAACTC
ATTGAATCTTATTGTCTTTCTCTTGACATATTCAAATCAAGAATAATCCCAGAGTTTTAA
ACAATTGATATGAACAACAAATAAGTTGGAGATAACTTAATTTGGTTATCTATTAAGTTG
TTAAACAAGCATGTCAAGAGATAATCCAATTTCATTTAAGTTTTGCAGAATTAAGATACT
TTAAATATTAATGAAGCAAAAGATTAACCAAGTTCCAATTAATTATGGAATTAAGAGGTA
CAAGATTAACTCATTCTAAGAATCATACAAATAGTTAATGATCCCAAACCTTTGTAACAA
ACATCTTCTAATGTTTACTACCAGAAATTGAATGAGGCTTTAAAGTATCTGTAGATCTTA
AAAGCAAACGATTAAGTTAATTCTTGTGCCAGTAACTTTTATGGGGAATTCTTTGGCATT
TTAATGACTATGAGGATGTCAAAAGTGAGTATCAAACACATGCTGCTTGATAATTAAACA
AATCACTTGCTTTTAAAGAAGTGGGCTATGCTAGCTAAAAGAGGCAAAGATTTCTATGAT
AACGACGAAACTAAATTCTTTCAATCACTTTATAGAAAATGTCTCTCTGAAGTACTTACC
TCATCTCAGACTCCCACCCCATAACAACTTAAAATCTCGCTAAACTTCCTTGATTTCCTT
AATTTCTATCTGAGTTCAACTCAACCTAGTGACGAGAGTCGCCAGTTCATTATTTACATT
CTTTAAGATGAGCAAACTATAGTCAGATGCAAGTTTAGCAGGGTTATGAGAGAGGGAGAA
AATATGGGATTTTTAGGGATTAGCGATGCCTTTCAGAAAAGAATTGATGAGCTCAAGCAC
TACATTAATTATCCTATTGCAAACAACGAAGATGAAACTCAATAGGACGAGAAAGTGAGA
TCTCCAGAATAACAGAGAGATTAAAGATTCTACAAAAGATTGCAAACTTTTAGCAATCTA
TGTTTCAAATACTTTGGAGAGGACTATAACAAGATAACTTCTCAGCTCGTTGGGTCCATC
GATCTTGAAGAAAATCTCAGAGAAATCTTGATGAGATTCGAAGATAAAGACTTGAATATA
ATCTTCAATACTCTAAGCATAAACATACCCAGTGATTTAATGTCAAATTTACAAGGACTG
TCTACTGAACAATTAAAGTTGGAAATATTAGTTGAAGAGCTCTCCAGATATCACTCTATT
AACATCAATCAAGATGTGGCAATTTTCCCAACTGAGGAGGATTTGTTATAAATTTCTTCT
TCTTTCCCTACTTAAACACAAACGAACCCACTCAACATTACTTAGTAAATTTCACTAAAA
AGACAAAACTTAGTGGCTTAAACCGAGTATCTTGACATATAGGATTATTTACTGAGATAA
TTTGATAATAGAATGGAGGAACAAACTCATCATGTAGCCAAACTAATTGAAGATTAGATT
GTCAAGTGCAAACCTCTATTTGGTGAGGAGACTGGAGACTTCATTGATTTGACTGGCTGG
GCTACTTAAAGTGCAAGAATTGAAAAAATTAGCATTCTTGATGTTAAAGCTCCTAAAATA
GGTCATACTAATCCTAGTGAAGTGATAGCTGAAATCTAATTCAGTTTGAAAAATCTGCCA
AATCTTGTAAAATAAGAATGGTTAAGTTTAAAGCCAAACAATCCACTCTTTTTCGTTTGC
TTAGATAAATCCCAAGACTATTAAAAAACTTCCGCAAAAAACAGCATTTCAATTACCTAA
GGCATAAAATTAGTTAGAGGCTGCTTTATAAAGATGAATGAAGTTTCAAATTTAGTGGTA
AACCCTGTAGAGTTAGGTAATGCTATCAATGAAAAATAATCTGCAAGTTAAATCACTTAA
GCATTCTCCCCTAGCGATACATACAAAGTTTAAGTTCAGCTTGATACCATACAATATAAA
CAAGACCTTGAAAAGCTTATGGTCTAGAAGTCAAAGTTTCTAGAAGAAATTTATTCAGAC
TCTCAGCTTTTAATCAGAGTGAGTGGGGAAGATATAAGTCAACTAAAAAAACTCTCTTTG
CTTAAAGAGCTATATGACGATGCAATAAGTTAAGGGAACCTTGATTAATGGATTCAGGAA
TTCGTTTTAGGAAAATATGAAAGCTATGAAGATGAGGACGAAGAAGAAGAGAATAAGCAT
TAAGAATAAGGTAGGATTTAGTTGAAAGACTCTTCAGACGTAGATTAGATCTTGGATTTA
ATGGAGAAATAGAGAGTAATTATAGTAGAAGGAGCACCAATCAGTGGAAAAACTACACTC
GCCGCTGAACTTTCTAAGAATCTTACCTTGTTTAAACCTGAAGACCACTTGATCTAAGAC
AACTTAAGGGTTCTTCTAGTGAGCAAGAATGACCAATCGATAATTCAATCCCTTAACTAT
TTAAGTGAAATAAACTATAATGTTCAGGATCTAATAATGATGTCGAACGAGAAATCTAAG
ATCCCAGCAAACTACGATGTAAATCTAAGAATAAATGGTTTGTTACAAAGAAGACTTGAT
TTGTTGAATGAGGTTACTAGTTTAGCACAAAGTGTAAATTATACAGTTTTCTAAGAATTC
ACTTGTGAAAGAGCAAAGCTTTTCTTTGATCATTACCTTAAACCACTGTGGGAGGCATAT
TTAGAGTAGAGTAAAACAAGGGAAGATCCAAGCAAATACCTCATCTATAACTTTCCATTC
AAGCAATTCATCAGCCAATATCTAAGTATTGAGCCTGTCGATGATAGTATGCTATTTTCA
GATATATCATGTGCTCAAGGTAGAGCTGCAGAGTATTGGATGCTGATCGAGATAATCTTT
CAAGATTTACAAAAAATATTGCCATTTGAGAACCTGAGAGACAATTCAGAGAGAGCTAAA
TTCATAACATGTTAACAAGCTAAGATAGTAGGAATGCCTATAGATTATGCCTTATCAAAA
TACAAGAAACTGTAGAAGAATGGTTTTAAGTATGACATTTTGATGGTAGATGATGCATCA
TTAATGGATGATTTAGACATTTACCTGCTGCTTAATATTCAAAGCTCAATGAGTAATCTC
AAGAATATCGTGCTAATTGGAGATCCAACTCACTATCATTTCAAGCCACAGTCAAGTATC
ATTAGAAGATAAAATCTGAAAAATTACTCAGCACCTATTTTCACTCTTCCAACTCCAAAC
TTATCAGATTTCATATGCTAATCTTAGAATCAAATTAAAGGTTTTGTTAGCTCAAGACAA
ATAATCTAAGTTAACGATTTCAAAGGCGTGGTTCAAAATCTAGCTGAAGCTGAGTTCTTA
GTAGCTACCTATATGTATTTAAGATTGCAGAGTGGCATACCTAAAGACTAAATTACTATA
TTGACAACTGAGATAGGGTAGCAATACTTAATATAGGACATTTTGAGATAGAAATGTGGA
TGGCATCCACTTTTAGGTCAACCCACACAAGGTGTAAAATTGATTAGGGATATCTAAGGG
AAAACAGGAGATGTACTGTTGATTTCTTTAGTTTATAGTAACTTTGATGAAAATGTATAG
AGCACTATGAATTAAGATCTTTTAAAGTGGCTGCTGACTAGAGGAATCTAGGCTAATTTT
GTATTCTCAAGAAATCAATTTATTAGTCCACTTGTTCCTCAAATCTAAACTAATACAATG
AAACTAGAAGAGAACCTAGAAATATCTACTTTTATCCAGATGTATAAAACAGTCTAAGTT
ATCCTTGAAGAACAAGAAAAAGATCAAATTACAGCTTTGAAAGAGCAACAAGCTCTTGAA
CATTAGAATAGACAACAGCAATATTAACCTAATCGAGGCCGTGGTGGTTATAGAGGGAAC
AACCCGAGAGGAGGCTATAGAGGTGACCACAGAGGTGGTTAAAGAGGAGCTTATAGGGGT
GGGTATCAGCAGTAGAACTAGATGTAGGTCCAAAGAGATGCTTACTAGCAGTAAATGTAC
CAGGCTCATATGGGAGGTTACTCGTAGTAAAACAACGAGTAGGATCAACAGCAATAGAAT
CAGAGAGGTGGTCAAAGAGGTGGTAACCGAGGTGGTCCAAGAGGAAGTTCAAGAGGTGGT
GATAGAGGAAACTCAAGAGGCGGCGACAGAGGTAATTCTAGAGGTGGCGATAGAGGTAAC
TCTAGAGGTGGCGATAGAGGAAGCAACTAAAGAGGCGGCCAACAGAAGTCTTAAAATCGT
GGTGGTAACAGAGGCCGTGGAAGAGCTCATTAGAATTAATGA


>Contig2692.0.g56(protein)
MSTKANTNAQQQDFQKPDNVEMKELNQFSTPAFYQEVDLQLLYGHLYDNHQNLTRKQQKL
IESYCLSLDIFKSRIIPEFQTIDMNNKQVGDNLIWLSIKLLNKHVKRQSNFIQVLQNQDT
LNINEAKDQPSSNQLWNQEVQDQLILRIIQIVNDPKPLQQTSSNVYYQKLNEALKYLQIL
KANDQVNSCASNFYGEFFGILMTMRMSKVSIKHMLLDNQTNHLLLKKWAMLAKRGKDFYD
NDETKFFQSLYRKCLSEVLTSSQTPTPQQLKISLNFLDFLNFYLSSTQPSDESRQFIIYI
LQDEQTIVRCKFSRVMREGENMGFLGISDAFQKRIDELKHYINYPIANNEDETQQDEKVR
SPEQQRDQRFYKRLQTFSNLCFKYFGEDYNKITSQLVGSIDLEENLREILMRFEDKDLNI
IFNTLSINIPSDLMSNLQGLSTEQLKLEILVEELSRYHSININQDVAIFPTEEDLLQISS
SFPTQTQTNPLNITQQISLKRQNLVAQTEYLDIQDYLLRQFDNRMEEQTHHVAKLIEDQI
VKCKPLFGEETGDFIDLTGWATQSARIEKISILDVKAPKIGHTNPSEVIAEIQFSLKNLP
NLVKQEWLSLKPNNPLFFVCLDKSQDYQKTSAKNSISITQGIKLVRGCFIKMNEVSNLVV
NPVELGNAINEKQSASQITQAFSPSDTYKVQVQLDTIQYKQDLEKLMVQKSKFLEEIYSD
SQLLIRVSGEDISQLKKLSLLKELYDDAISQGNLDQWIQEFVLGKYESYEDEDEEEENKH
QEQGRIQLKDSSDVDQILDLMEKQRVIIVEGAPISGKTTLAAELSKNLTLFKPEDHLIQD
NLRVLLVSKNDQSIIQSLNYLSEINYNVQDLIMMSNEKSKIPANYDVNLRINGLLQRRLD
LLNEVTSLAQSVNYTVFQEFTCERAKLFFDHYLKPLWEAYLEQSKTREDPSKYLIYNFPF
KQFISQYLSIEPVDDSMLFSDISCAQGRAAEYWMLIEIIFQDLQKILPFENLRDNSERAK
FITCQQAKIVGMPIDYALSKYKKLQKNGFKYDILMVDDASLMDDLDIYLLLNIQSSMSNL
KNIVLIGDPTHYHFKPQSSIIRRQNLKNYSAPIFTLPTPNLSDFICQSQNQIKGFVSSRQ
IIQVNDFKGVVQNLAEAEFLVATYMYLRLQSGIPKDQITILTTEIGQQYLIQDILRQKCG
WHPLLGQPTQGVKLIRDIQGKTGDVLLISLVYSNFDENVQSTMNQDLLKWLLTRGIQANF
VFSRNQFISPLVPQIQTNTMKLEENLEISTFIQMYKTVQVILEEQEKDQITALKEQQALE
HQNRQQQYQPNRGRGGYRGNNPRGGYRGDHRGGQRGAYRGGYQQQNQMQVQRDAYQQQMY
QAHMGGYSQQNNEQDQQQQNQRGGQRGGNRGGPRGSSRGGDRGNSRGGDRGNSRGGDRGN
SRGGDRGSNQRGGQQKSQNRGGNRGRGRAHQNQ