Identifiers and Description

Gene Model Identifier

Contig20170.0.g42

Standard Name

APEX1c

Aliases

Contig20170_0_g42

Description

Endonuclease/Exonuclease/phosphatase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03372 ) Endonuclease/Exonuclease/phosphatase family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007946002.0005330067840427e-93exodeoxyribonuclease III famil
y protein
SGDYBL019W0.000000000029994712494008525APN2 SGDID:S000000115, Chr II
from 184353-185915, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20170.0.g42(coding)
ATGAACCGTCGAGATCCAAATAGTTTTTCAGCCAATAAAAGAAAGCAAATTTACGAGAGA
CATTTAGTACCAACAGACAAGGGACCAGTCGCCAAGTTTAAAAAGATAGCAGAAAAGAAT
GCAGCTAAGGGCCAGAGCTCATTAGAGAAATTTATGGGACCACAGAATGGCGATGGAGTA
AAGAGCAACCAGGCGGCATTCTAACATTATGCTGTTCAATCAAAGTCCCACAGATAGACA
AGGAGCAATTCGCCTCTCAATAACGAAGAATATGAAGATAACGGAGCCGACACTACTGCC
TCATCAAACGGTAAAACTTCTCAGCCCAATTAATAGAACCAAAATTTTGAAAACAATAAC
AAAACTCAGTATAATTCCAATTCACAATACAAGAATTCAATGAATGGAGATAATCAGATG
CTCGGGAAGAGGACGTTTGTTGGCTATCAGAAGAACGAATATGGGAAATAAAATGGCTAT
GGTGGAGGCTACAACAAAGGGAATGGATAATTTAATAGAAACAACAATTCCTACTAAAAT
GGAAATAAAGGGGGTAATATGCAATACAACCGGGACAATAAGTATAACTAGAAGCATCCT
AACAGCAATTAATAGTAACAGCAAAAAGGAGGTTTACAGCTTAGGCAAATTCAAAGACCA
ATGAACATTTAGGAGCAAAACTAGAATATTGACATGTCAAGGCTACAAATATGGTCTTGG
AATGTTAACGGTATAAGAGCAATTTTGAAGAAGAACCGTATTCAGGAATTTTTTGAACAA
GCAAATCCAACAATTCTTTGTGTTCAAGAATCAAAGATAGATGAAGAACGTATGGCAGCT
GACAAAGTCAAAGATAAATTTCCCGCTGATTATTTGCAATATTGGAACTGCTGCAAACCT
CCTATAAAAGGCTATGCTGGAACCATTATTTTCTCTAAGATTAAGCCAATAAGCGTATCT
TATGATATTGGAGTTCATAAACATGACAAAGAAGGCAGAACAATCACTCTTGAATTTGAG
AAATTCTTCTTAGTCGGAGTATATGTACCAAACTCTGGTGCAACTTTGAAGTGGCATGAT
TATAGGTGCAGTGAATGGGATTTAGATTTTAGAGCATACCTGAAAGGACTGGAAAGACGA
GGCAAACCAGTCATTTTATGTGGAGATATGAACGTAGCTCACTAAGAAATAGATATTTTC
GATCCTAAAAGAAACGAAAGAATGGCTTGTTTCACTAACGAAGAAAGACAAAGTTTCTCC
AATTTTACCAAAATGGGATTTGTAGATACTTTCAGAGAGTTATATCCTGGAAAGATCAAA
TACAGCTTTTGGGATATCAGAGATAAGAGTCGTAAAGAGAACAAAGGATGGCGCTTGGAC
TATTTCATGGTGAGTAGATAGATTAAACACGCTCTGACAGATGCTGAGATTCATAATGAA
TTCTGGGGTAGTGATCACTGCCCTGTTAGTTTGACTCTAGACACAACCAAGATAAACTTA
GAGGAATTTAATGAGTACATGAACACAGACTTAGACGATGACAAAGATGAGCTTGACATG
GAAGATGCTCTTAACGAAGAGGTAAAATCAGACCTCGAAGACGATTAAAACCCAGACGAG
TTTCAATACTAATATGATGAAAATGATGAGGAAGCTGATGAAAATCTGGGAGAAAAGTTT
AACAATGGTGATGACGAGAATGACTAAGAAAATCCAGAGGAAAATCAAGATGATGATGAT
TAGGAGGAAGACTTAGGTGATGATGCTCTTGCAGGAGGACAAGATGATGACCCTGGAAAT
GATTTAGAAGAAGAAGACAATAATAATAACAACGCAGGGGATGGAGATGAAGATTCTTAG
TGA


>Contig20170.0.g42(protein)
MNRRDPNSFSANKRKQIYERHLVPTDKGPVAKFKKIAEKNAAKGQSSLEKFMGPQNGDGV
KSNQAAFQHYAVQSKSHRQTRSNSPLNNEEYEDNGADTTASSNGKTSQPNQQNQNFENNN
KTQYNSNSQYKNSMNGDNQMLGKRTFVGYQKNEYGKQNGYGGGYNKGNGQFNRNNNSYQN
GNKGGNMQYNRDNKYNQKHPNSNQQQQQKGGLQLRQIQRPMNIQEQNQNIDMSRLQIWSW
NVNGIRAILKKNRIQEFFEQANPTILCVQESKIDEERMAADKVKDKFPADYLQYWNCCKP
PIKGYAGTIIFSKIKPISVSYDIGVHKHDKEGRTITLEFEKFFLVGVYVPNSGATLKWHD
YRCSEWDLDFRAYLKGLERRGKPVILCGDMNVAHQEIDIFDPKRNERMACFTNEERQSFS
NFTKMGFVDTFRELYPGKIKYSFWDIRDKSRKENKGWRLDYFMVSRQIKHALTDAEIHNE
FWGSDHCPVSLTLDTTKINLEEFNEYMNTDLDDDKDELDMEDALNEEVKSDLEDDQNPDE
FQYQYDENDEEADENLGEKFNNGDDENDQENPEENQDDDDQEEDLGDDALAGGQDDDPGN
DLEEEDNNNNNAGDGDEDSQ