Identifiers and Description

Gene Model Identifier

Contig14003.0.g71

Standard Name

APEX1b

Aliases

Contig14003_0_g71

Description

Endonuclease/Exonuclease/phosphatase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03372 ) Endonuclease/Exonuclease/phosphatase family
  • ( pfam03761 ) Domain of unknown function (DUF316)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007946002.9990539278805726e-74exodeoxyribonuclease III famil
y protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14003.0.g71(coding)
ATGCCTGAAGTAATCCCACATATTTATGGCAAAGCCTTATACGAAGACTTTCCACAAAAT
AAAGTTAACATTTGGCATTGGAACATAAACGGATTACAATCTGTAATAAATAAGGGTAAA
ATTCAGGATTTTATGACAAAAACAAACCCAGATATCGTCTGCTTCAATGAAACTAAGACA
GACTTGGAGAAGATATTCAAAGATAATTTCCATTCTCACATTGGCTAAGAATATCAATAG
TATTGGAATTGTTGCAAAATTAGAAAGGGTTATTCTGGAACTGGCTTACTGACCAAGGTT
AAGCCGTTAAGAGTGGATTTTGATTTAGGTATTAGTAAACATGACAATGAAGGTAGAGTA
ATCACGGCAGAGTATAATAAATTTGTGTTAATCGGAGTGTATGTCCCTAATGCAGGAGAT
GGATTAAAAAGGCTGGATTACAGAACTTAAGAGTGGGATAACGACTTCCATGATTACATT
GATAGAATTAAGGTAGAACGAGGTAAGCCAGTTATATTGACTGGGGACCTGAATGTCGCT
AGAAACGAATAAGATGTCTATGATACTAAGGGAAAAGATAAGGTAGCTGGGTACACTCCC
AATGAAAGGGGAAACATTGAAAGATTTTTTGATCGGGGATATATCGATACATACAGGCAT
TTACATCCTGAGAAGGAAGAATACACATTCTTTTCTTATAGAATAAGTGGAAGGGAGAAT
GATATGGGCTGGCGTTTGGATTATTTTATAGTTGACAAAGATAATATAAATATGGTTGTA
GACAAGCGTATTCATAAGGTTTTCGATGGTAGTGATCACGTACCAATAGAGCTCGAGATT
GATCTTGGTAAAATTGGTTAGAAAAAGAAAGAAAATGCTAAGAAATCCCCGAACAAGTTG
ATTAATGATAAAGAAGAGATTTAGAAATTGAAAATCAGTAGCACTGAAACTGATTGA


>Contig14003.0.g71(protein)
MPEVIPHIYGKALYEDFPQNKVNIWHWNINGLQSVINKGKIQDFMTKTNPDIVCFNETKT
DLEKIFKDNFHSHIGQEYQQYWNCCKIRKGYSGTGLLTKVKPLRVDFDLGISKHDNEGRV
ITAEYNKFVLIGVYVPNAGDGLKRLDYRTQEWDNDFHDYIDRIKVERGKPVILTGDLNVA
RNEQDVYDTKGKDKVAGYTPNERGNIERFFDRGYIDTYRHLHPEKEEYTFFSYRISGREN
DMGWRLDYFIVDKDNINMVVDKRIHKVFDGSDHVPIELEIDLGKIGQKKKENAKKSPNKL
INDKEEIQKLKISSTETD