Identifiers and Description

Gene Model Identifier

Contig11259.0.g51

Standard Name

AOS1

Aliases

Contig11259_0_g51

Description

ThiF family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005197608.00089003463867e-30ThiF family protein
SGDYPR180W7.000402845995459e-29AOS1 SGDID:S000006384, Chr XVI
from 895961-897004, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11259.0.g51(coding)
ATGGAAAACTTTGATCAGGTAAACAATCCCGCAAATAAACCCACAGACTCTTCTACTACT
GCAATCCAAGATGCACAAGGTGACAAGTTGAATGAAAGTGAGTTCAAGGTGTATGATCGT
CAACTGAGAGTTTGGGGAATTGAGGCTCAAAAAAAACTGAAGGATGCACTCGTGCTTTTG
GTGAATATGTCTTCAGTTGTGACTGAATGTGCCAGACATTTGACACTAAGCGGTATCAAC
TTGCATTTGGTGGACAAGACTCAACAGTTCGTAGAGGAACATGACACTCAAAGCGATTTC
TTGTTTTCACATAGTGATATTGGAAAATTGAGAGTGCAAGTTGTGGCAGAGAAGTTAAGA
GAAATGAATCCATTTGTAAAGATTACTTTTGAAACAAAATTGAATCAAAGTGATTTACTT
AAGGATGGTTTCTTATGTTTGGTCTAAAATTCCTCTCCCTCTCATCAATTGCAACAAAAG
TCTTTCTCAGCTGTGATTCAAGGTTTCAGTTCCTTCCAAGATGCTGAAACTATGAACAAT
TACTGCAGAGATTCTACCATACCCTTCTACGTGCTTAACTCTAGCGGCTTGAATGGTTTC
TTCTTCGCTGATCTTGGCAAGTCCTTTGAGTTTAGCTATCGTAGAGGTCAGAAGGATGCT
CAAACAGATTAAAGTGAAATCGTTTAGAGTTCTTTGTCACTTCAGAGTTTCTTGCAAAGT
TTCGCTTCAAGTGAGGAGAAGATACAGTGGAATAGAAGGCAAAGCAAGAATACTCAAAAG
TTTGCATTCCTTGCTTTTCTTGCCTAAGCCTTGAAAGAGAAACATTTGAACAGTACAACT
TTAACAACCTCTACAATTCCAGTTGACTAAACTATGACCACTTAAACCCTCAACTGTCCA
ACTACAGACGACACTACTACTTTATTGCAAAACTTAAAGATCTTGCTTACTGCTAAGTCT
CTCCCAACCACACTTGTAGACTCTTCAGATTTCCTTGCTATATTCAATCAGATAGACAGA
TGCTTCAACTTAGAGTTTAATCCCTCAGCCAGTGTGATCGGAGCCCTAGTTTCATAAGAA
ATTGTGAAAGTAATCACTCAGAGAGACTTTCCAGGATGGGGTATGTTCATCTATGATTCT
GACAGCCAATATTGCACTCAGGAACTGCTTTTGTGA


>Contig11259.0.g51(protein)
MENFDQVNNPANKPTDSSTTAIQDAQGDKLNESEFKVYDRQLRVWGIEAQKKLKDALVLL
VNMSSVVTECARHLTLSGINLHLVDKTQQFVEEHDTQSDFLFSHSDIGKLRVQVVAEKLR
EMNPFVKITFETKLNQSDLLKDGFLCLVQNSSPSHQLQQKSFSAVIQGFSSFQDAETMNN
YCRDSTIPFYVLNSSGLNGFFFADLGKSFEFSYRRGQKDAQTDQSEIVQSSLSLQSFLQS
FASSEEKIQWNRRQSKNTQKFAFLAFLAQALKEKHLNSTTLTTSTIPVDQTMTTQTLNCP
TTDDTTTLLQNLKILLTAKSLPTTLVDSSDFLAIFNQIDRCFNLEFNPSASVIGALVSQE
IVKVITQRDFPGWGMFIYDSDSQYCTQELLL