Identifiers and Description

Gene Model Identifier

Contig13298.0.g98

Standard Name

ANP32e

Aliases

Contig13298_0_g98

Description

Leucine Rich repeats (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010792001.000361553249356e-16Core histone H2A/H2B/H3/H4 fam
ily protein
SGDYPL213W0.0002999184360822198LEA1 SGDID:S000006134, Chr XVI
from 150614-151330, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13298.0.g98(coding)
ATGTTGATGGATGGCTTGAAACTCAATTATTTAAAAGTTGAAGACCAGTAGTTTCTCGAG
CTCTTCACAGAAGTGACATCCCTCTCCTTGAACAGCTGCCAGCTTGTAAACCTCCTGAAC
CTTCCAATGCTCCCAAAACTCTCCAGATTAGAACTATAGGACAACAAATTGACTGGCGTA
GAAATACCTCTAATTGTTGAGGTCTATGGAGACACCTTGGAAATACTAAAATTAAGTAGC
AATTTAATCAGAGACTATGATTTGCTGAAGCCGCTGACTGAGATGGCGGAGGGTGTACTT
ATTAATTTGGATTTGAGCAACAATCCCATTAATGAAATCATTCAATACCGTGATCAGATA
TTCGACTTGCTCCCTCAATTGGAGATCCTGGATGGATTGGACAAAGAGGGCAATGAAATC
AACTCTGAAAATGATCAAGAATGCGAGGAGTATGATGTAGGTGATAAGCATGATGGAGGG
GCAGTGATGAGCGACGATGAAGATGACGAAAACAGTGATGGGCTGGAAAGGGTTGATGGT
GGTGCTTTTAGTGAGGGTAGTCTAGATGATGTTGGCTCTGATAGCAATCCAACTAACAGT
CAGAAGAGCGATGAAGAGGAAGGCGGCTAGGTTGCTGATTAAGCTAGCATCAGATCATCA
AGCAGTAGCAGCAGTGATTCAAATAAAGAGAGCAGTGGCAGCGATTCAAGTAGCAGTAGC
AGTGAAAGTGATAATGAGAAACCTGTTTTAAAGTTAAAGTCTTCAGATAAAAAGAGCACG
AGGCAAAGCACAGAAAATACTAATACCTACGATGCAGATGATGGCTATTCATCAGGAGAC
GAAAGTATGCCTGACCCCGAGGATGCAGTTTATTAAGGATTCGAAGCTTTGGGTGAGATG
ATTGACGATCATGAAGAGCGCATGTAGCAAGAAGAACAAGCTCTGACTATGGAATTGATT
AAAAAACATCATCCAAAGATGCCAATGACTTCAACTTTAAGCACTGGAAATTCTGGAGTA
TTCTCACAACTTACATTAGGTGTTGGTGATTAATCAAGTATGCTCTCAACTAAATCTATG
AGTCCTGCAATTGGGAGCAGTGGATAATATAATCTAGCAGGTATGAGTGTTGATGAAGCT
TAATAGTTGAGTGTTATCAGTGAAATAAGCAGGAAAAGAGTGAGATCAGGGAGAAAAAAG
CAAGAAAGTTTAACAAAAGGAGACAGTGGATATTTGAGATAAAAGATTAAGAGAACAAGA
ATTTATTGA


>Contig13298.0.g98(protein)
MLMDGLKLNYLKVEDQQFLELFTEVTSLSLNSCQLVNLLNLPMLPKLSRLELQDNKLTGV
EIPLIVEVYGDTLEILKLSSNLIRDYDLLKPLTEMAEGVLINLDLSNNPINEIIQYRDQI
FDLLPQLEILDGLDKEGNEINSENDQECEEYDVGDKHDGGAVMSDDEDDENSDGLERVDG
GAFSEGSLDDVGSDSNPTNSQKSDEEEGGQVADQASIRSSSSSSSDSNKESSGSDSSSSS
SESDNEKPVLKLKSSDKKSTRQSTENTNTYDADDGYSSGDESMPDPEDAVYQGFEALGEM
IDDHEERMQQEEQALTMELIKKHHPKMPMTSTLSTGNSGVFSQLTLGVGDQSSMLSTKSM
SPAIGSSGQYNLAGMSVDEAQQLSVISEISRKRVRSGRKKQESLTKGDSGYLRQKIKRTR
IY