Identifiers and Description

Gene Model Identifier

Contig10998.0.g28

Standard Name

ANP32d

Aliases

Contig10998_0_g28

Description

Leucine Rich repeats (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003286100.0000000000000030004923591262316Leucine Rich Repeat family pro
tein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10998.0.g28(coding)
ATGTCAAAATCAAAAGTAGAGGAATTTGTACTATCTAAACTAAAAAACAGAAAACTCATT
CCTATAAATTATGAAAACATGTTGATGGATGGCTTGAAACTCAATTATTTAAAAGTAGAA
GACCAGTAGTTTCTCGAGCTTTTCACTGAAGTGACATCCCTCTCCTTGAACAGCTGCCAG
CTTGTAAACCTCCTGAACCTTCCAATGCTCCCAAAACTCTCCAGATTAGAACTCTAAGAC
AATAAATTAACTGGCGTAGAAATACCTCTAATCGTTGAGGTCTACGGAGACACCTTAGGA
AATACTAAAATTAAGAGCAACTTAATCAGAGACTATGATTTGCTGAAGCCACTGACTGAG
ATGGCGGAGGGTGTACTTATTAATTTGGATTTGAGCAACAATCCCATTAATGAAATCATT
CAATACCGTGATCAGATATTCGACTTGCTCCCTCAATTGGAGATCCTGGATGGATTGGAC
AAAGAGGGCAATGAAATCAACTCTGAAAATGATCAAGAATGCGAGGAGTATGATGTGGGT
GATAAGCATGATGGAGGAGCAGTGATGAGCGATGATGAAGATGACGAAAACAGCGATGGG
CTGGAAAGGGTTGACGGTGGTGCATTTAGTGAGGGAAGCTTAGATGATGTTGGTTCTGAT
AGCAATCCAACTAACAGTCAGAAGAGCGATGAAGAGGAAGGTGGCTAGGATGCTGATTAA
GCTAGCAACAGATCATCAAGCAGTAGCAGCAGTGATTCTAATAAAGAGAGTAGTGGCAGT
GATTCAAGCAGCAGTAGCAGTGAAAGTGATAATGAGAAACCTGTTTTGAAGTTAAAGTCT
TCAGATAAAAAGAGCACAAGGCACAGCACAGATAATACTAATACCTACGATGCAGATGAT
GGCTATTCATCAGGAGACGAAAGTATGCCTGACCCCGAGGATGCAGTTTATTAAGGTTTT
GAAGCTCTTGGTGAGATGATTGACGATCATGAAGAGCGCATGTAACAAGAAGAACAAGCT
CTAACCATGGAATTGATCAAAAAACATCATCCAAAGATGCCAATGACTTCAACTTTAAGT
ACTGGAAATTCTGGAGTTTTCTCTTAACTTACATTAGGTGTTGGTGATTCATCAAGTATG
GTCTCAACTAAATCAATGAGCCCAGCAATTGGGAGCAGTGGATAATATAATCTAGCAGGT
ATGAGTGTTGATGAAGCTCAATAGTTGAGTGTTATCACTGAAATAAGCAGGAAAAGAGTG
AGATCAGGGAGAAAAAAGCAGGAAAGTTTAACAAAGGGAGACAGTGGATATTTGAGATAA
AAGATTAAGAGAACAAGAATTTATTGA


>Contig10998.0.g28(protein)
MSKSKVEEFVLSKLKNRKLIPINYENMLMDGLKLNYLKVEDQQFLELFTEVTSLSLNSCQ
LVNLLNLPMLPKLSRLELQDNKLTGVEIPLIVEVYGDTLGNTKIKSNLIRDYDLLKPLTE
MAEGVLINLDLSNNPINEIIQYRDQIFDLLPQLEILDGLDKEGNEINSENDQECEEYDVG
DKHDGGAVMSDDEDDENSDGLERVDGGAFSEGSLDDVGSDSNPTNSQKSDEEEGGQDADQ
ASNRSSSSSSSDSNKESSGSDSSSSSSESDNEKPVLKLKSSDKKSTRHSTDNTNTYDADD
GYSSGDESMPDPEDAVYQGFEALGEMIDDHEERMQQEEQALTMELIKKHHPKMPMTSTLS
TGNSGVFSQLTLGVGDSSSMVSTKSMSPAIGSSGQYNLAGMSVDEAQQLSVITEISRKRV
RSGRKKQESLTKGDSGYLRQKIKRTRIY