Identifiers and Description

Gene Model Identifier

Contig5621.0.g90

Standard Name

ANP32c

Aliases

Contig5621_0_g90

Description

Leucine Rich repeats (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003286100.0000000000499999055251093Leucine Rich Repeat family pro
tein
SGDYOR353C0.000005998506718272351SOG2 SGDID:S000005880, Chr XV
from 1000828-998453, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5621.0.g90(coding)
ATGCAGATTCAAGAAATTTCCGATGAAGACAAGACCTTCCTCGAGGGATTCTCAGAGACT
CAGTTCCTATCAATGAACTCAACTTAACTCAAATCCATTGCCAATCTGCCTAAAATGGTA
AAGTTAGAGAGACTAGAGCTTAACGATAACAAAATAGGATCCTCATCAGATAGCCTACTT
TCACTGATACCTGACCTCTATGAGAATTTGAGAGTACTGAAGATCAGCAACAATTCAATA
AAAACTATCGAAGAGATCTAAGGACTGGCTAAATGCCCCAAATTGGAGTCATTAGACTTA
AGCAACAATCCCATTGTCACAGAGCTAGGGGAAGAGTACACTGCTAAGATCAGAGAAATG
CTCCCTAAACTCGATATATTGGATGGGCTGAATAGAGACGGCAATGAAGTGGTCAGTGAG
GATGAAAGCGAGGATGATGAGGAAGAAGGAGAAGGCGAGGATGACGCTGAGGATGATGCC
GAGGAAGATGGCGATGAAGAGGATGACGGTGAGGAAGACCCCGATGATGAAGAGGAAGAG
GGCGATGAAGAAGGTGATGAGAACGATGAGGAAGAAAATGGTGCTGCTGATGACTAAGCA
GGTGGAGCTGATGGCGTAGAAGGTAAATTAGTGGGTAAAAAGAGGAAAGCTAGTGAAAAG
AATGGAGCACCAGCTGATGCTAACGGTGATTCTACTGAGGCAATTGAAGGAGGCCTTGAT
GCCACTAAGAAGAGAGTTAATGTTGACCCAAGCTCATGA


>Contig5621.0.g90(protein)
MQIQEISDEDKTFLEGFSETQFLSMNSTQLKSIANLPKMVKLERLELNDNKIGSSSDSLL
SLIPDLYENLRVLKISNNSIKTIEEIQGLAKCPKLESLDLSNNPIVTELGEEYTAKIREM
LPKLDILDGLNRDGNEVVSEDESEDDEEEGEGEDDAEDDAEEDGDEEDDGEEDPDDEEEE
GDEEGDENDEEENGAADDQAGGADGVEGKLVGKKRKASEKNGAPADANGDSTEAIEGGLD
ATKKRVNVDPSS