Identifiers and Description

Gene Model Identifier

Contig184.1.g62

Standard Name

ANP32b

Aliases

Contig184_1_g62

Description

Leucine Rich repeats (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003286100.000000000003001226732525078Leucine Rich Repeat family pro
tein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig184.1.g62(coding)
ATGTCTTAAATTGAGGAAGTATTAGCAAAGAGAGCAGAAATCGAAATAATTTCCGAAGAT
TATGAGACACTTATCTTGGATGATTAATTATTCTACGAGTTGACTACTTAAGATAAATTA
TATTTGGAATCTTTCAAGAATTGTGCATCACTCTCATTCTAGAATTGTGCACTTAAAAGT
CTAATCAATTTACCTGCTCTGCCCAATTTAGTGCGATTGGATGTATCGAACAACAGACTG
TGGCAATCAGCGAAGGATTTATCAATTATAGCAAACACCTACCCCAAATTAGAAACTCTT
AAACTTGGCAATAATTTGATTAAGGGGGATTGGGAAGGCATGAAAGTAGCATTGAGTAAG
CTGGGAGAGAGTTTGATTAATTTAGATCTCAGTGCCAATCCCATCAGTGAGAATAATAAC
ATGCAGTATAGAGAGTAAATGTTTGAAATGTTGCCACTGCTAGAAGTGCTAGATGGCTAT
GATAAAGATAACAAAGGTGTCTACAGTGATAATGACGATGATGATGAAATGGTTGATGGG
AGAACTAAGAAATCAATACTGAAAAGCGCACAATAAAAATTGTCAAGCCAGAGAAATACT
GAAGCTGCCAAAGAAAAAACTCAGGTATCTGCTCCTAATACAAGTAAGATGGTAAACTTA
GATGATGACGAAGAAGATGAAGATGCCGATGTAAATGAAGAGAGTAAAGGTGGAGATAAG
GATGATGAGGAAGATGATGACTATGGAGATGAAGAGGAAGATGTCTAGGAAGAAGAAGCT
GATGAGGAAGAGATTGAGGGTTACTACGCAGAGGATGAAGATGGTGAGCAGGGTAAAGCT
GATGATAAATAAAATGAAGAAGAAGATGACGACGAGGAGGATGATGAAGAAGAAAATAGT
GATGATAGACTGTTCAGTTCAAATTTAGGCAAAAGAGTGGGAGGTCCAGATGCTGCTGCT
CAGTTTGCTAGTGCTAATAAAATTCAAAGAACTCACTGA


>Contig184.1.g62(protein)
MSQIEEVLAKRAEIEIISEDYETLILDDQLFYELTTQDKLYLESFKNCASLSFQNCALKS
LINLPALPNLVRLDVSNNRLWQSAKDLSIIANTYPKLETLKLGNNLIKGDWEGMKVALSK
LGESLINLDLSANPISENNNMQYREQMFEMLPLLEVLDGYDKDNKGVYSDNDDDDEMVDG
RTKKSILKSAQQKLSSQRNTEAAKEKTQVSAPNTSKMVNLDDDEEDEDADVNEESKGGDK
DDEEDDDYGDEEEDVQEEEADEEEIEGYYAEDEDGEQGKADDKQNEEEDDDEEDDEEENS
DDRLFSSNLGKRVGGPDAAAQFASANKIQRTH