Identifiers and Description

Gene Model Identifier

Contig9263.0.0.g83

Standard Name

ANP32a

Aliases

Contig9263_0_0_g83

Description

Leucine Rich repeats (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003286105.997739233660418e-28Leucine Rich Repeat family pro
tein
SGDYPL169C0.0004000184047659232MEX67 SGDID:S000006090, Chr XV
I from 230838-229039, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9263.0.0.g83(coding)
ATGTCGCTTAGAGAATAAGTACAAAAAATGCTTAACGCAGACGAAGAACTCAACCCAACT
GAGTTCAGCAACTTGATCTTAGATGAGTTGAGAATCGATAATCTCTCTGCTGAAGACAAA
GCATTCTTAGAGGAATTCACAAATCTCGAACTCCTTTCTATGAATCAAACATAAATAAAG
TCAACTCAGAACTTCCCTGATGCACCCAACCTTGTCAGACTGGAGTTAAATGACAACAAG
TTACAAGGATCAGAGTTAAAGAACCTCACTAAGTACGAGAATTTGAGAACCCTTAAATTT
GCCGGCAATCTCATCAAAGATTTAAGCGATCTTGGCTCTCTTAAAGATCTAAAGCACTTG
ATGAACTTGGATCTCACTGAGAACCCAGTCACATCTCAAGACGGCTATAGAGAATCAGTC
TTCGGAACCTTCCCAACTCTAACGGTTCTTGATGGTCTCGATGCTGAAGGTGTCGAAGTG
TTGAGTGAGGATGAAGAAGATTACGATGAAGAAGGCGACGGAGAAGACGGAGAGGAAGAA
ATTGATGAGGAGACATTCAAGAAGTTAAGAGAAGAAGCATTAGCCAGAGGAGAAGTTTTC
CCCGAATACGATGATGAGGAGGACTACGACGATGAAGAAGGCGATGATGAATACGGTGAT
GAAGATGATGAAGACGAAGAGGAAGATGGTGTTGGAGCTAAGAGAGGAGCCAGTGGCAGT
GATGCTGGTGCAAACAAGAGAAAGAAGTGA


>Contig9263.0.0.g83(protein)
MSLREQVQKMLNADEELNPTEFSNLILDELRIDNLSAEDKAFLEEFTNLELLSMNQTQIK
STQNFPDAPNLVRLELNDNKLQGSELKNLTKYENLRTLKFAGNLIKDLSDLGSLKDLKHL
MNLDLTENPVTSQDGYRESVFGTFPTLTVLDGLDAEGVEVLSEDEEDYDEEGDGEDGEEE
IDEETFKKLREEALARGEVFPEYDDEEDYDDEEGDDEYGDEDDEDEEEDGVGAKRGASGS
DAGANKRKK