Identifiers and Description

Gene Model Identifier

Contig17336.0.g99

Standard Name

ALKBH5b

Aliases

Contig17336_0_g99

Description

AT hook motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003712203.9983110956465888e-22hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17336.0.g99(coding)
ATGTAAACAAGAGGAAAACAGAAAGTTTGTTACTTCGATGGTTAAAAAAGAAGACCAAGG
TCAGTTTAACCTCAATAGAAAAGGATGAAACTTGATGAACAGAGGTAAAATAATCCAATT
GAAACTGTTCAATAATAAGTCACTGAATTTTTGCCTTTGCCAAGAAAAAGAGGGAGACCA
AGAAAAAATCCTATTTAATAAGAGCCTGTTTAAAAATTAGCAAAAAAAACGACCAAATAA
AAAACTAAACAGCAACAAAAGACATTAGACATGTCCTAATCTTACCAAGCTGAACTGAGA
AGTCAAGAGCTGAAACATGAAATATGCTTGAATACAACTGAAGATGATACAGATGATGAT
GACAAAAAAACAATAATTAAATTAAAGAAGAAAAACAAATATGAGAAGGAAAATCACAAA
GAGTACATCCCAGATTTGGATGACTTACTCAAAATCAACAAAAGGGAAACTAAGATTAAT
GCCAAATAAGAAGCATCATTAAAGAAAGAAAACAAAAAAGTACAAAATATCACTACTTTA
TCTCAACTCGTAGAAGAGGTTTATAGGGAAAGCTCTTGCATAAATCCATTTGACAAAAAT
ATAAGAGAGCAGTAACTGGATTTCATTGATTTCACTAAAAATGACCAAGAAAATGAAAAC
TACAATCCTGCTCTTCTACAAAAAGAATAATTTATGAGTTCTAACATTAGAGAACATCTT
ATTCACTAACAGTCGTAGAAAAGTCTCAGTGTAAAAAGAATGTGTGGAGTTTCATATGTT
ATGGAATCAGAGTCAAAGCAAATAAATGTAGATAAAGACTATGATATACTTCCTCCCATA
GTAATGCAAGGTTCATATAATGTTCAATAACTATCAGATAAAATTTAGATTCAGTAGGTT
GACAAAATACTGAATGAAATGCTGAAATCAAATAGAACTCTAGTAGTGTCTGCTTTTCAA
TCATAGGATGAAGCAGCAATGAAGAACTACTTGCTTAGGAATGACAAAAGATTGGAGATA
TGCTAAGACAATATTTACTTGATATAAAATGGAATGGTGGGAGTCTGGCCTCTTATAAAT
GATTAGACATTCATTTGCTTTCACTTCAAATACGATAACCATACACTAATTAAAACAGTA
GATAATGACTTTGACGTCAAAAGTACCAATGGAAGGACAGGTGCTAGTCATAACCATTTA
GCTCATTCAAATCTTAAGAGTAAAGATAAGTAATATGTTAAGAAAGTACTAGAATTCTTA
AGAGACAGTGACATATAAATAGGAATACTATTTAAGAAAGGAATGGCATCAAAAGACAGT
TTCTTAAAAGCCTATGGCTAAGAAAAATTGGCGAAAACTATTAAGAGTGACAGGAGGAAC
AAAGATATGACTGATACATCTTACTACAGTGTTAGGAATGAAAGTTTATAATCAATAATA
GGATGTTAAATTCAAGACTTTGACTAAAATGGTGTTAACATTACAGCATTGATAGGAAGA
TTAGAACTATATGTGGAAGAAAGCAAATGGAAAGAATGCCCTACCTTAACAAAAGAATAC
TTATTAACACTCATAAATAGAGTTGAGGATCACCTATAGGAATGTCTTCTGAGGTAGTGG
AACCAATAAAGATCGTAATGCCATAATTATACATCTAACTAAAAAAATAAAGCAAATATT
CTTGTACTAAAACTTAATCAGTCAAAGAATGAACTCGATTTGGCAGACACATAAACGTAG
TCAATTGAAATCATCGTTACCAAAAAGAATAATATCTCAGAAAATAAGTTATTAGCTGGT
ATCCACAATCTTTCTTTGCCATTATCATTGATTAACACTAGGGATTGCTTCGCTTTCGAA
TTAATAACAGAAAGTGAACACATTACCGAATATTAAGATAGACCAAATTTAATTAAGAAA
AAGTATTACTTAAACCCAGAAAACCTCCCTGAGAACTATCATAAGTTTATTGACTCCAAA
ATATTGAAAGATCCTGAATTGAAGTCAGATTTTAGAAACTATCCTATAGGAGTGACATCA
TTTGAGAATTTCTTCACTCATGGAGAGTTATTAAACATTGAAGAAAATGTAATGGAGACT
GAAAGGCAATGCTCTAATAGCGCTTTCTTGCCAGATACTGCTTAGCAAACATTTTCAGGA
TCCAGACTTACCAGAACTAAATTCTTCTTTGGCTACAGATACATGTGGACAAAAGAATAA
TTGAGTGAACCATTTAGTCAAGTTGCAGCTGGAGTTAGAAAAGATGTTTCTCGTCCTCCA
GTATGGGTTAATGAATTTATGGTGAGTAAAATGGAGAAATGTGGAATTGTAGAGAAAAAT
TTCATAAATTCAATTGCAATGAATGTTTATCATGATGGTACTGAAGGATTAGCTTAACAT
TATGATGATGCAACTAGATTCAAACAATTCTATGGATTTGTAAATGGAGCATTTTTCATA
CCATTAGCTAGAGGATGTATTTGTGTTATGGAAGAAAATGGGTATGCTGCAAATGGAGTA
AAACATTGCATCAGACCTTAAGATATGACAGGGAAATCTGCTGCTCTAATATTGAGGTAG
ATGCACCCAAATGTAGTTAAAGAGGCAGAGTTATATGATAGATTCGTAGAGCTTCCTATG
TGGATGAGCACTCTTTCCATAGAAGATGCCAGTAAACCATTTAAAAGCTAGAAGACTTAA
GAAGCCAAAGATATCATGCACATTGAAGAATAATGCAAAAAGAATAAAAAGAACAAACAA
TAAGTATTATCATAAAAATCTAACTAAGATCAAGAACTTTCACAATAAGCAATGATGGGT
GATCCTTTATGA


>Contig17336.0.g99(protein)
MQTRGKQKVCYFDGQKRRPRSVQPQQKRMKLDEQRQNNPIETVQQQVTEFLPLPRKRGRP
RKNPIQQEPVQKLAKKTTKQKTKQQQKTLDMSQSYQAELRSQELKHEICLNTTEDDTDDD
DKKTIIKLKKKNKYEKENHKEYIPDLDDLLKINKRETKINAKQEASLKKENKKVQNITTL
SQLVEEVYRESSCINPFDKNIREQQLDFIDFTKNDQENENYNPALLQKEQFMSSNIREHL
IHQQSQKSLSVKRMCGVSYVMESESKQINVDKDYDILPPIVMQGSYNVQQLSDKIQIQQV
DKILNEMLKSNRTLVVSAFQSQDEAAMKNYLLRNDKRLEICQDNIYLIQNGMVGVWPLIN
DQTFICFHFKYDNHTLIKTVDNDFDVKSTNGRTGASHNHLAHSNLKSKDKQYVKKVLEFL
RDSDIQIGILFKKGMASKDSFLKAYGQEKLAKTIKSDRRNKDMTDTSYYSVRNESLQSII
GCQIQDFDQNGVNITALIGRLELYVEESKWKECPTLTKEYLLTLINRVEDHLQECLLRQW
NQQRSQCHNYTSNQKNKANILVLKLNQSKNELDLADTQTQSIEIIVTKKNNISENKLLAG
IHNLSLPLSLINTRDCFAFELITESEHITEYQDRPNLIKKKYYLNPENLPENYHKFIDSK
ILKDPELKSDFRNYPIGVTSFENFFTHGELLNIEENVMETERQCSNSAFLPDTAQQTFSG
SRLTRTKFFFGYRYMWTKEQLSEPFSQVAAGVRKDVSRPPVWVNEFMVSKMEKCGIVEKN
FINSIAMNVYHDGTEGLAQHYDDATRFKQFYGFVNGAFFIPLARGCICVMEENGYAANGV
KHCIRPQDMTGKSAALILRQMHPNVVKEAELYDRFVELPMWMSTLSIEDASKPFKSQKTQ
EAKDIMHIEEQCKKNKKNKQQVLSQKSNQDQELSQQAMMGDPL