Identifiers and Description

Gene Model Identifier

Contig13665.0.g61

Standard Name

ALF

Aliases

Contig13665_0_g61

Description

Transcription factor IIA, alpha/beta subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03153 ) Transcription factor IIA, alpha/beta subunit
  • ( pfam04546 ) Sigma-70, non-essential region
  • ( pfam03247 ) Prothymosin/parathymosin family
  • ( pfam05320 ) Poxvirus DNA-directed RNA polymerase 19 kDa subunit
  • ( pfam09026 ) Centromere protein B dimerisation domain
  • ( pfam13254 ) Domain of unknown function (DUF4045)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR194C0.00007000107212225429TOA1 SGDID:S000005720, Chr XV
from 712543-711683, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13665.0.g61(coding)
ATGACAACAAATGCGAAAGATTTCTACTTGGCTGTTGTAAATGAAGTAATTGAGAAGAAC
AGACAGCAGTTCATATCAGAGGGAGTGTCTGAGGATGTTCTCGAAAAATTGAGGAAGATT
TGGGAGGAGAAAATCAATCAGAAACTCACCCCAGAAGCTGAACCTAAATTTCATCATGAT
TTTCACGGGGGCCAAGATCCAAATTACTCTGCGGGAAGAAGCGGGGCTTACCCATCTTAC
TGGAATCCTTAATACTATTAGTACTAGCAAATGATGCAACATCATTATCAACAGTAATAG
ATGATGAGAGGTTTCAATATGCAAGGCATGCCTCCAGTTGGCTTTGGTTAACCAGGCTCC
TCTGCTTTTCATCCTCCTCAACAAGCAGTGGTTTCTTAGCTTGGAAAGCGAGAAGAGCCA
ATGATTCAACCAGGAATCAACAGAGAAAGCAATGACCTTGGCGATTAGTCAAGAAAATTG
AAGAGACCTCGCACAGGAAACAACAACGATGGTTTGAGCGATGACGAAGAGGATGAAGAG
GGCGACGAAGAAGACGACGATGAGGAGGAGGAAGAAGATCCTGATGAAGCACTTTTTAGA
CAGTAAACAGCACAGAACAATGATTAACAAGTTAAGACTGAGAACATCAGCCAAGCACAT
ACTGCTACTAGTGCTCATGTTCATTAAGAAATTGTAGTTAATCAATCGAGAACAGTGCTA
TATGAAGAGAGATCCTTAGTTGCAGATCGCAGACAGCCTTATCAAGGCGACGAGGAGGAG
AAATAAAGTGGGGCACCAAATGCTCCACTCTTCAGGACTGAACTCTAATAGCGAGAAATG
GATCAGCAACAAGAGGATAGCGATGAGGATGACGACGACGATGAAGAAGATATGCGCTAG
CAAGATTGCAAAAATTATATTGCCGCTCAATATGAAAAAGTTCAGAGAACCAAGCAAAAG
TACAAGTGCATCTTCAAGGACGCCATCATTCACTTAAATGGAAAGGATTTCGTTGTCAAG
AAGTTCACTGCCGATATAGAATATTGA


>Contig13665.0.g61(protein)
MTTNAKDFYLAVVNEVIEKNRQQFISEGVSEDVLEKLRKIWEEKINQKLTPEAEPKFHHD
FHGGQDPNYSAGRSGAYPSYWNPQYYQYQQMMQHHYQQQQMMRGFNMQGMPPVGFGQPGS
SAFHPPQQAVVSQLGKREEPMIQPGINRESNDLGDQSRKLKRPRTGNNNDGLSDDEEDEE
GDEEDDDEEEEEDPDEALFRQQTAQNNDQQVKTENISQAHTATSAHVHQEIVVNQSRTVL
YEERSLVADRRQPYQGDEEEKQSGAPNAPLFRTELQQREMDQQQEDSDEDDDDDEEDMRQ
QDCKNYIAAQYEKVQRTKQKYKCIFKDAIIHLNGKDFVVKKFTADIEY