Identifiers and Description

Gene Model Identifier

Contig13843.0.g37

Standard Name

ALBA8

Aliases

Contig13843_0_g37

Description

Alba

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13843.0.g37(coding)
ATGATGAAAAAAGATAAATTTAGCAAATACTATCACGAGGCCTCTAAATTGCCAGATAAC
GTGATTAAAGTCTCAAAGAGTGGTTAGGCTCACAAATACATAAATTATGGAGTAAAAAGA
ATTATTAAATTTGGTGATTCCAAAATCAAAATCTTTGGTGCTGGAAAATCTATTGAAATG
GCTTTGAAAGTATCTGAGTAGATCTAATTCAAAATAATGAAAAAAGAATAAAATCATCAT
TTGGTTTAGATAATTGATATTTCATCAGTTGAGATGCATTAGAAAATTAATTTGCCCAGA
GGAGGGGATTTTGATGAATTACTGTAAAGTTAAAGCATGGTTTTTATCAAGCCTTGTATC
AAAATCACATTGACCTTAGAACATGATGCAAATTAACATTTACATTATGGTTACTAACAC
CCACGATATGCTTCATACTATTCTGATTAAAAAAAGATTCCTCGAAATCACTCTAGAGAA
AGACGCTTAGGTTTAGCAATAAGAGGTGGGAGAAGTAGGCCCAGAACTTCTGCTGCTATA
GCCTTAGGAGATATCGATTTTTGTGCTATTTCGTAGGGACAAGAATCCTATAGAAGAAAT
GCAAGAGGAGGGAGAGGAAGCAGGGGTGGTTTACAAAATCGGCACCCTTATTCCTCGATT
CTCGAAAGAATATCAGAAGAAAGACATGCAAGAAGTTTGAAGAGAGCCTATGGTAAAAGA
AGCGAATCGGCAAAGACAGAAAGTATATTAGGTTCAATCGATATTTAAAGGAGATAAAGA
CCTCCTTTTAGAGAGGGAGGAATTTACCCTTCTACTTTAACGAGTTAATTAAATCTGAGA
AGTAGAGATCATATTCCAATGCGAGAAAGAGGAACTACTATGATGCAAGGTTAAAGAGTC
ATGCCTTAAATGAGTAGAAGTATAGACAGTTAAATTAGGGGTGTGGAATTTGATAGACCT
TTAAGAGGAATGGGAGATGATCGTCTCCCTCCAATGAGAGGAGGTTTTAGAGGAATTCCC
TCAATGAGAGGAGTTAGAGGTATGCTTCCAATGAGAGGGGGTAGAGGTATGCCTCCAATG
AGAGGAGGATTTGGAATAATGCCAATGAGAGGTAGTTTCAGGCCTCCAATTAGAGGTGGC
ATGCCATCATCGAGAGGATTTTTCGGAAATATGGACATGTTAATGAGAATGAGAGGTAGA
TTTCTAGGCATGAATATGACAAATATAGGAAGAGGAATTGAAAGTCTAAATGTAGGTAGA
GGTAGCAGAGGCATGGAAATGCCAATAAGAGGGAGAGGTAGTGAGAGACCATATAGAGGT
CGTGGGATGCCCATGAGAGGCATGCCTCCTAGAATTTCAGAAAGATAAAGTGACTATCCA
TATCCTTAAATTGAAGGTTCTCTAAAGACTTTTACCTAGGGCTAAAAATTAAAGTTGATT
TCCTTGATCAGCGAAATACCCTATTACACATCGTTATGCACAGAATAAGAAAGAATTAAA
TATGCTTAAGATATGATAAGAGTTTATTAAAAAGGAACAATGTCTTTACCTGTTGAATTC
AATATTGAAAATAATTATGAAACATTTGAGCTTCCTCCATCTCATAGTTTTCATAATGAT
TAAGCAGAACAACATTAATAATCCAGGTCTAGATCAAGATCTAATGAGAGAAGGGATTTA
TATCGATTAACTGAGAGTCTCTAATTTGGGAAATTTCGTGGTGAACGAGGAGGCCGTGGG
AGTAGAATGAGAGATTATGGTAGACTTCAACACTTGAATGAAATCGAATCTGATGTCATG
AGAGGCAGAGGGGGCATGAGAGGAGGTCGAGGAGAATTCAGAGGAATAGGAGAAATGAGA
GGTCGAGGAGATTTCAGAGGTAGAGGAGATTTTAGAGGTAGAGGAGAAATGATAGGAAGA
GGAGAAATGAGAGGTATAGAAGAATTTAGAGGTAGAGGAGACTTTAGGGGTGTAGGAGAA
TATCGCGGAGAGATGAGAGGTCGTGGAAATATTAGGCGTCGTGGTGACTTTAGAGGCCGT
GGTGAAATGAGAGGTAGAGGAGAATACAGAGGCCGTGGAGAGATGAGAGGTAGAGGAAGT
TTCCGAGGAAGGGGTGAAGAATTAAGAAGAGAATTTGGAGAATACAGAGGATCAATGAGA
GGCGTTAGAGGAAGAGGAGGTTTACATAGAATCAATGAAGATGAATCTCTTGAAGAGCGA
AACTATGAATGA


>Contig13843.0.g37(protein)
MMKKDKFSKYYHEASKLPDNVIKVSKSGQAHKYINYGVKRIIKFGDSKIKIFGAGKSIEM
ALKVSEQIQFKIMKKEQNHHLVQIIDISSVEMHQKINLPRGGDFDELLQSQSMVFIKPCI
KITLTLEHDANQHLHYGYQHPRYASYYSDQKKIPRNHSRERRLGLAIRGGRSRPRTSAAI
ALGDIDFCAISQGQESYRRNARGGRGSRGGLQNRHPYSSILERISEERHARSLKRAYGKR
SESAKTESILGSIDIQRRQRPPFREGGIYPSTLTSQLNLRSRDHIPMRERGTTMMQGQRV
MPQMSRSIDSQIRGVEFDRPLRGMGDDRLPPMRGGFRGIPSMRGVRGMLPMRGGRGMPPM
RGGFGIMPMRGSFRPPIRGGMPSSRGFFGNMDMLMRMRGRFLGMNMTNIGRGIESLNVGR
GSRGMEMPIRGRGSERPYRGRGMPMRGMPPRISERQSDYPYPQIEGSLKTFTQGQKLKLI
SLISEIPYYTSLCTEQERIKYAQDMIRVYQKGTMSLPVEFNIENNYETFELPPSHSFHND
QAEQHQQSRSRSRSNERRDLYRLTESLQFGKFRGERGGRGSRMRDYGRLQHLNEIESDVM
RGRGGMRGGRGEFRGIGEMRGRGDFRGRGDFRGRGEMIGRGEMRGIEEFRGRGDFRGVGE
YRGEMRGRGNIRRRGDFRGRGEMRGRGEYRGRGEMRGRGSFRGRGEELRREFGEYRGSMR
GVRGRGGLHRINEDESLEERNYE