Identifiers and Description

Gene Model Identifier

Contig15169.0.g18

Standard Name

ALBA7

Aliases

Contig15169_0_g18

Description

Alba

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15169.0.g18(coding)
ATGAACACCTACCAATCAGACAACAGAGTTTCAACCAGACCTACTGGCATGAACAACAAC
AGCAGCTATCAACAACAGAGATACCAGCAGGATGGCAACAACACTCGCAGCAACAGACCT
ATGAACGAGGGAGGAAGCGGTGGCAACAACTACAACTAAAATCGCTACAGTCAACCCTAC
TCTACTCAACAACATTTTGCAAGTGACACCATGAACTTGAAGAAAGGAGGTCTACTCCCC
AATGAGATCAGAGTAAGCGCTAAGAACTCTACTATCAACTCTATCGTCAAGCAGATCACC
TATGTTCTCAGGAATGGTTTCCAGAACGTCAAACTTGTGGGAAGAGGCCAAGCTTGCTAA
CTCACTCAAGATATCGTCGCTCACTTGCGTGAAAACACAAACATGCCTTCTTCGTATTCT
TTTGATGTTAAGAATACTTCAGCTTTCAACATCATTGGAGAAGTGGTTGATGAACTGCAT
GTGATGATCAGAGAGAGAACCAGCGCTCATGCTAACTCTGGAAAAGCACCAGAATCCCAA
ACTCTCAACCATCAAGGGAGACCAACCAACATGAACTCCTAATCTTCAGCAAACACCTAT
CGTCAACCCAGACAATTCCAAACTATCACAAGTTAAACTTTGAATGGACCTGTGACTGAG
AAGAATGGCGGTGGAGTGCAAGGTGCTGGTGGAAGATACTTGACTTCTTATGGCAACACC
AAGATCATCAGAGATGATGTGCCCTACTCCATGAGACAACAACAGCAAGTTCAGCAATCG
TATCCTCAACAGCAGAAGAGAAGAAGTCCCTCACAAGAGTTTGATCAGAGAAGAGGTGAC
AGAGATGGAGGTCCAAACAGCAGTCGCATGATTCAACAGCAACCTCAAAGAAGACCCTTC
AGAGATGACTACGAGATTCCAAGATCTACCAGACCTCTTCAAACAGTTGGCTATGCATCC
GGCACCACTCAAGAGCCTAGACTCTAGAACAACAGAGGCTATCAACAGAGAACTGAGGGA
GGCTAGAACACCTATCGCAACTTCTAGAGATCAGATGTGGCCAATGATGGCGGTGCGGGT
GGACAAAGATCTACTGGTGGCAACTACACTGAGAGAAGAGAGTTGCAAAGATACAGCAAC
AACAATGGCTACTCTCAACAGAACACTGACAGAGTCCAGACTACTGGCAATGGTGGTGGC
TATGCAAGAAACATGGGCAGTGGAGCTCAACAGATGAGAAATTCTCAGTATGTGAGAAAG
GAGAACAACTACCAACCTTCTTCAGGCAACACTGGCTACGGTTCAGGCAGATTGAGAACC
GAGGGAGGATACGGTGGCAACAGAAGGATGACTGGCAACTCCCAAGGCAGAAGACCTCAA
GGTGGCTACTAGAGAGACTCCAACAGAGGAGGAGACTTGATCCGCGGCAACAACAGTGCA
GTCAACAACGGCATCAACGAGCAAATCTTGGTGGTTGACAGAGAAGCAGCTGGCAGAGAT
TCCCCCATCATCGAATGA


>Contig15169.0.g18(protein)
MNTYQSDNRVSTRPTGMNNNSSYQQQRYQQDGNNTRSNRPMNEGGSGGNNYNQNRYSQPY
STQQHFASDTMNLKKGGLLPNEIRVSAKNSTINSIVKQITYVLRNGFQNVKLVGRGQACQ
LTQDIVAHLRENTNMPSSYSFDVKNTSAFNIIGEVVDELHVMIRERTSAHANSGKAPESQ
TLNHQGRPTNMNSQSSANTYRQPRQFQTITSQTLNGPVTEKNGGGVQGAGGRYLTSYGNT
KIIRDDVPYSMRQQQQVQQSYPQQQKRRSPSQEFDQRRGDRDGGPNSSRMIQQQPQRRPF
RDDYEIPRSTRPLQTVGYASGTTQEPRLQNNRGYQQRTEGGQNTYRNFQRSDVANDGGAG
GQRSTGGNYTERRELQRYSNNNGYSQQNTDRVQTTGNGGGYARNMGSGAQQMRNSQYVRK
ENNYQPSSGNTGYGSGRLRTEGGYGGNRRMTGNSQGRRPQGGYQRDSNRGGDLIRGNNSA
VNNGINEQILVVDREAAGRDSPIIE