Identifiers and Description

Gene Model Identifier

Contig19012.0.g62

Standard Name

ALBA6

Aliases

Contig19012_0_g62

Description

Alba

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19012.0.g62(coding)
ATGTCAGAAGAACAACTATCTTCCCAACCTCAGCTCCAAGACTCCCTCAAGATCCAAAAC
AATTTTTCTCTCCTTGATCGTAAGTACATCATGAATATTAAAAGCGAAGGAAACTTTGCA
GTGTATGTGAAAGTCGCAGCAAGACTACTGAAAGATCCTAATGCACAAATGATACAGCTC
TCTGCCTGCGGATCTGCAAGTTTGCAGTTGTTCAAAGTTTCCTCAATTCTAAGTGAATAT
TTCCCTGAGCTTCACAAGATGACCTACTTCACTTACTCTACTTGCTACACCTGTTAATAC
AAGAAGCAGAAGCATGGTAATTCCGGATCTATTCAGCAGTTTATGAACAGACAAGTAATC
CAAGAGGATTAGAGAAAGATATGGGTTCCTAAAGATTCAAAAGATACCTCAAGCACAAAC
CAGACTTTAGACACAGATCCATCAAATTCTGATCAGAGTTAAACTGATCCAAAGAAAGGA
CTTTCAGCTCAGCTTGACTATGAAGATCACAGCAATGAAGAGATTCAAGAGTTCATTAAG
AGCTTCGACGATGCCAATTTTCAAGACATCTGTCAAGAAGATTTTCTGAGCACCAAGAAC
AACTTCTTAGTCGTGCACAATTGCAATGATCCCAGAACATTCTCATGTCTTATCACTATG
AACTAAAGATTAGCATTTAGGTAAGATGTATTGGACAAGAAGCACCCTGGATACTCCAAG
CCAACTGTGACTCTGAAAAACAAGTTCACACTAGAGTAGCTTATTCAGCAATTCAGCAGA
ATTGACGACGATGATAAGCCCTACAGACAAGACTTCAAAGGAAAGTTTGGAAGAGATACC
TTTCAAAGATCTTAAGATGATGAAATGGAGAATAATCCTAAGGAATTAAAGACTTTTCCA
AGAGGATCTTTGTTCAGAGAAGCTCCAAGAAGATCAATGTTTAGTGCTTCTAACTCACCA
CTTTCAAGTTTCAACCCACACAAGAAGATAAAGTTCATCTCAGACTCAGCATCAAATTGG
TCATCCTCTTAGAGTCCAATCTCTTGGAGAAGTACATCCTACAATCCAATTAAATCTGAC
TCTAAGGTGTTTTTAAGACCATCATTTTTGCAGAGACAAATTGACTACAGCTCCCAATTT
GCAATGGTGAAACCTCCCAGACATTCGCCAAGGCAACATAACCCTACTTATGTCTCCAAG
CCTAGACCTCAATTTTCATTCAACTAGAGTATCAGGCCAAGACCACCCACACCTCACAAT
GGATATCAGAGTTCTCCTTAGACATGGTAGTAGCAATCGCAGGTGTAGTAGTAGCAACCA
TAAGTGCAGTAGCAACAGTACTAAAATTCAAGCTTTTAGACTTTTGGAAGCTAAAACCAT
TCCTCCTACTCAAATTAGATACATCCTATGCATTAACCTCATCATGGTCATTAGAACTAG
GGATATCAGAGTCAACCCCCTACTTCGACTTGTCTACACTAGCCACCCTAAATGCCAAAC
TATTCTCATTACTAACCTAATTTCCCTGCTTGCTATCCAAATCCCCAACCAAATGGGCAA
GTACCTCCTCCACCAGCTATGAATAACTTCTTCAACAATAGCTTGAATTAGTAACAACCT
CAACAACAATTCTAGCACCAGTACCCTCCATCCCCTCATCAAGGACAACATCCCAACTTC
AACTATGGCAGAATCCAAGCAGCTCCTCCTCTCCCAAACAATTTCTAGTCTCCTCAATAT
TTTGGTCACTATGATGCTTAAAATAGCGACTTCAGAACTTCACAAAACTGGAAGCCCAGA
GAATACTATTGA


>Contig19012.0.g62(protein)
MSEEQLSSQPQLQDSLKIQNNFSLLDRKYIMNIKSEGNFAVYVKVAARLLKDPNAQMIQL
SACGSASLQLFKVSSILSEYFPELHKMTYFTYSTCYTCQYKKQKHGNSGSIQQFMNRQVI
QEDQRKIWVPKDSKDTSSTNQTLDTDPSNSDQSQTDPKKGLSAQLDYEDHSNEEIQEFIK
SFDDANFQDICQEDFLSTKNNFLVVHNCNDPRTFSCLITMNQRLAFRQDVLDKKHPGYSK
PTVTLKNKFTLEQLIQQFSRIDDDDKPYRQDFKGKFGRDTFQRSQDDEMENNPKELKTFP
RGSLFREAPRRSMFSASNSPLSSFNPHKKIKFISDSASNWSSSQSPISWRSTSYNPIKSD
SKVFLRPSFLQRQIDYSSQFAMVKPPRHSPRQHNPTYVSKPRPQFSFNQSIRPRPPTPHN
GYQSSPQTWQQQSQVQQQQPQVQQQQYQNSSFQTFGSQNHSSYSNQIHPMHQPHHGHQNQ
GYQSQPPTSTCLHQPPQMPNYSHYQPNFPACYPNPQPNGQVPPPPAMNNFFNNSLNQQQP
QQQFQHQYPPSPHQGQHPNFNYGRIQAAPPLPNNFQSPQYFGHYDAQNSDFRTSQNWKPR
EYY