Identifiers and Description

Gene Model Identifier

Contig20822.0.g90

Standard Name

ALBA5

Aliases

Contig20822_0_g90

Description

Alba

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20822.0.g90(coding)
ATGGCAACTACTATCATAAACAGAGAAAACAGACCACCCATGAGAGAGATTGGAACTGCA
GGTAACATTATCAGCAACCACAGAGATTTTGAGAACAAGGACGGGCGTAGAGATCAGCGT
ATCTTTCCTCAGAAAGATATGAGATCTGGAGAAGGATTCAACAACAGAGATCAGAGAAGA
GACTTCAATCCTAATCCTAACTATGGTCACAACCCTAACCATGGACAGCAGCAGATGAGG
CCACCAATGGAAAGAGGCAATGGCTATCGACCACCTCATCAGTTTGAAAACAGACAGCAT
CCAGGAGGACCAAGAGCTCTCTTCAGAGAGGTACCATAAGGTATAGTTGGCATGAACGGC
GACACAAGATTCAGCAACTAAGGTCCTAATGGTGCTCCTTATCCAAGATTTGGTGGACCT
CAACAGGATCCAAGGAACTTCAACATGAATGGACCTGGTGGAGCTCAAAATTACTTCAAC
GGAAGTAATTTCAAGAGAGGTGGTCAATTTGGACCTGGTTTCAGAGATTCAGACAGAAAT
GGACAGATGCAGTTTGGCAGAGACATGAGACCAATGAGACCACAATTTGAAAACAGAGGC
TATGGAGAGCAAGGAAGAAGAGAGTTTGAAAACAGGAGATTTGAAAATCCTATGCAAGGT
AGAGATGGTGGCAGAGACAGAGACAAAAACAGAACTACCAACAGAAGATCAAGGTCTTCA
CAGAGAAGAAAGTCTGGTTCTCGTGGCAAGAAAGTGAATGATCAGGGCCGCAAGAGATTC
TCATCCAAGGACAAGCTTCAGAAGAGTACAGACAAGAAGATTGATGAAAATCAGACTGAC
TAGGAGAAGTAAAAGCCCAAGAAAGATCGCTCAACTTCCAACTAGAGACAGAAGAGTGAA
GAGAGATCAAGAAGAAACTAAGGTACAGGTCATGGTGATAGGTCAGCCTACTACCAATCA
GACCAGGTGATGGTTCGCAGAGACAGAAATCCAAAAATGTACATCAACATCGCCAAGAGC
ATCCTCAAGGACAAACATGATGTCATTGAAATTCATGGAGCAGGAGAGCTCTCTTTCTTT
GGTGCGATCAAGGTTGCTGAGGTTCTAACAAGGTACGGGTATGCAGATATCATAAAGTTG
AGAACTAAGTACATACTGGTTTAGAACTATAAGGTGGCTAAGATCATGATCAAAGTCAAG
AAGAGTGCTGACTTCGACAAGCTCTTTGATGCTTTCAATGAGGAGGTTGCCAAGAACAGA
CTGAATGGTGTTGGTTACCGCTTTTCAAAGCCCAAGTCAGAGAAGGATGCCAAGGTTGTG
AAGGGAACTTCAATCTCAGGAGACGAAGGTGTGGACTCAGGATCAACTCAAACTGACAAA
GGACCCAAGCCAGATGGAGCTGTGAGCTCTTCAGACACTGAATTGAATAACAACAAAGCT
CCAAGTGATCAAGCTGTGATCGATGAGGAAGAAGGAGTTCGTTCAGGCTAAGATGGATCT
CACTCAGAGAAAGACGGAGATGAAGGCGATGACGAGGGAGATTTAGAGCAGCTTAAACAT
GGCAAGAGAGTAGACAAGGATCAGAAGATCAACAACAGTCAAGATGAGGAGGCCATCCAA
CAAGATCACGATGAAGGAGTCCAGACTAATGCAACCATCACCGTAGACTTGACCAATCAA
GAATGA


>Contig20822.0.g90(protein)
MATTIINRENRPPMREIGTAGNIISNHRDFENKDGRRDQRIFPQKDMRSGEGFNNRDQRR
DFNPNPNYGHNPNHGQQQMRPPMERGNGYRPPHQFENRQHPGGPRALFREVPQGIVGMNG
DTRFSNQGPNGAPYPRFGGPQQDPRNFNMNGPGGAQNYFNGSNFKRGGQFGPGFRDSDRN
GQMQFGRDMRPMRPQFENRGYGEQGRREFENRRFENPMQGRDGGRDRDKNRTTNRRSRSS
QRRKSGSRGKKVNDQGRKRFSSKDKLQKSTDKKIDENQTDQEKQKPKKDRSTSNQRQKSE
ERSRRNQGTGHGDRSAYYQSDQVMVRRDRNPKMYINIAKSILKDKHDVIEIHGAGELSFF
GAIKVAEVLTRYGYADIIKLRTKYILVQNYKVAKIMIKVKKSADFDKLFDAFNEEVAKNR
LNGVGYRFSKPKSEKDAKVVKGTSISGDEGVDSGSTQTDKGPKPDGAVSSSDTELNNNKA
PSDQAVIDEEEGVRSGQDGSHSEKDGDEGDDEGDLEQLKHGKRVDKDQKINNSQDEEAIQ
QDHDEGVQTNATITVDLTNQE