Identifiers and Description

Gene Model Identifier

Contig11789.0.g22

Standard Name

ALBA2

Aliases

Contig11789_0_g22

Description

Alba

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11789.0.g22(coding)
ATGGAATCTACAGACATCAAGCCAGAGAGAAAAGGTCCTCCCAATCAAATCAATGTCTCC
AACAAGAGAAAGGCTAAGTTCTACGTCTACCTCGGAAAGCAGATCCTCAAGGATCACAAC
ATAATTGAGCTCCACGCTCTCGGAAACGCAGTATCCACCAGTGTTTAAGCCGCCGAAAAT
CTTGTCAGAAACAACTACGCCACCTTTAAGCAAATCAAAACTGAGACTGTTACTATGAGT
GACAACTCAAAGAAAGCTAAGCTCTTTATCACACTTGAGAAACATACCGATTTCGACGCC
AACATCGAGAAGTTCGAATAGATCAAGCAAGAAAACGAGGCTCTCGCTGGAACCTAAACC
AAGCAATGA


>Contig11789.0.g22(protein)
MESTDIKPERKGPPNQINVSNKRKAKFYVYLGKQILKDHNIIELHALGNAVSTSVQAAEN
LVRNNYATFKQIKTETVTMSDNSKKAKLFITLEKHTDFDANIEKFEQIKQENEALAGTQT
KQ