Identifiers and Description

Gene Model Identifier

Contig2112.0.1.g66

Standard Name

AKAP7b

Aliases

Contig2112_0_1_g66

Description

AKAP7 2'5' RNA ligase-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10469 ) AKAP7 2'5' RNA ligase-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2112.0.1.g66(coding)
ATGAATGAGGAAGAAATGGTAGAATATTTTAAATTACAGTCAAAATAAATGCACTAATTT
TTCAGAATAATCGAGTTTATTGAGAATATATATGGGTTTTCAAGTTTAAATACTAAGAAA
GTAAAGAGATTTGCTATTGGATAAATCAATAGTTATTGTATGCAAGCTGCCAAGAAAGTY
TTTAGAGGGACTTAGRTTGGAGATACCATATAGTTTAATAGATAATTTTCGCATTTCATA
TCAATTCCAATAGGTGAAAACGAAGCTATTAAACAAGTTTATAATGAATGGAAATGTTAA
GCATTAGCCAAAATTCAAGAAAGTAATCCTGGCTTGGAAAATGCAGAGAAATTATTTATA
AATCCTGAAAACCTTCACTTAACTATTGTCATGTTACCATTAAGAGAAGCTGGCTAACTG
TACAGATGTAAATAGGCGCTAATAGATATTTAGGATAAAATATAGAGCTTAATTAAATTG
GCTCTGTCAACATCTTTCATCTAAGAAAGTGAATAAATCAATACCAGCTCTAATAATAAT
TTAATCAATTTTGGTAAGAACCTCTAATATTTCGGGGATACTGCGCAGCAAACAAAGCTA
TCATATCTACCAATTAAGCTCAATGAAACCCTGCTAGATCTCTCAAGTCTGATTATTCAA
TAAATGCTTGACTGTGAAGTTGTAGACAGATCAGAATTGGAAGCTAATCACATAAAATTG
AATCTGGATAATGGAAGTTAGCTATAAAGATTAGAAAGATAGAATAAATCAATCGAAGAA
AGATAAAAGTTAACCAGAAAACAACTCAAGAGATAGAAGTTAAAGAGGGGGATTTTCAAA
TAGTAGGGGAAGAGGATCAAGAGGAGGTTTTAGGGGTAGAGGGAGAGGTAAAGGTAAGAA
ATTCCAAGGGAAACATGGTGA


>Contig2112.0.1.g66(protein)
MNEEEMVEYFKLQSKQMHQFFRIIEFIENIYGFSSLNTKKVKRFAIGQINSYCMQAAKKX
FRGTQXGDTIQFNRQFSHFISIPIGENEAIKQVYNEWKCQALAKIQESNPGLENAEKLFI
NPENLHLTIVMLPLREAGQLYRCKQALIDIQDKIQSLIKLALSTSFIQESEQINTSSNNN
LINFGKNLQYFGDTAQQTKLSYLPIKLNETLLDLSSLIIQQMLDCEVVDRSELEANHIKL
NLDNGSQLQRLERQNKSIEERQKLTRKQLKRQKLKRGIFKQQGKRIKRRFQGQRERQRQE
IPRETW