Identifiers and Description

Gene Model Identifier

Contig9698.0.1.g40

Standard Name

AKAP7a

Aliases

Contig9698_0_1_g40

Description

AKAP7 2'5' RNA ligase-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005816400.00000019998969434520019hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9698.0.1.g40(coding)
ATGGAGAATTTAATGAATTTCACTGCTGCCTCAGTAGTTGCCTCACATCGTAAAGTTACG
CTCAAGAAGATTCAATAAGTCTCTAAGCAATGGGTTTAGAAGGGATGTTACTCAAGTAAG
TTCGAGTAGTGTGATGAAGAAGAGGAAATCAAAGTGAGTTAGCAATCAGATCAAGGTGAT
CCTACAAATTTTGCAAAATCATCAAAATCACATCGATATTCCCTACATTAATAGAGTTAT
TACTAAGATAGACAATTAAAGGCAGAAGGAAAGGAATTCACACAAATTGAGGGGGAACAC
AAAGAAAAGAGGAATTACTAGAGAAACAAGAAAGGAGGAGTAGGATTTACACATTTCTTG
TCTTTGCCTATTGCGTCTGATAATCTTAAGAAAGTTTATGCTGAGTGGAGAGACAACATT
GTGAAGTAGAACTATGAAACTATTTGGCCTAAGCTATTCCTTGATCCAAGACGTATTCAT
TTCACTTTGTGTATGTTAAGACTAGAAAATGAAGAGTAAATTGAATAAGCCAGGCAAGCT
ATGAAAACTGTTGAAGTATAGATCCAGACGCTAATCAATGAAAACGGACAAAAAGGCAAA
CTTATGGTTGAATTTGATTAACTGCACTATTTCGGAAAACCTGAAGACACCAGAGTTATC
TACCTTAAATTAAAGGAAGAAGGGGATTAATATTAGCTCCTGCTCAATGTAGTGGACATA
CTTGTGAGATAAATGCTTGAAAGCAAAGTGATTCCATCTCATATGAACCTGAACAACTTC
ACTTGA


>Contig9698.0.1.g40(protein)
MENLMNFTAASVVASHRKVTLKKIQQVSKQWVQKGCYSSKFEQCDEEEEIKVSQQSDQGD
PTNFAKSSKSHRYSLHQQSYYQDRQLKAEGKEFTQIEGEHKEKRNYQRNKKGGVGFTHFL
SLPIASDNLKKVYAEWRDNIVKQNYETIWPKLFLDPRRIHFTLCMLRLENEEQIEQARQA
MKTVEVQIQTLINENGQKGKLMVEFDQLHYFGKPEDTRVIYLKLKEEGDQYQLLLNVVDI
LVRQMLESKVIPSHMNLNNFT