Identifiers and Description

Gene Model Identifier

Contig5743.0.g73

Standard Name

AIMP1d

Aliases

Contig5743_0_g73

Description

Putative tRNA binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005585908.003017249547689e-39TRNA binding domain containing
protein
SGDYGL105W5.997612587164444e-16ARC1 SGDID:S000003073, Chr VII
from 307437-308567, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5743.0.g73(coding)
ATGAAAAGTAGGAATCACTTGACAATCAATCAAGATTGGAGTAAATTATCTGTGATAAAC
AGCACTTAGGAGTTGTATACACCTCAGATAGGTCTCAAGAAAAAGTTTTTGGATGCCAAG
AAATTGTCATTAACGCCAAGAACCAATCAGACTATGGATGAGAAGTGGAAAGTTTTTGAG
AGATGTGATTTAAGAGTTGGGAAAATCGTTAAAAGCGAGCCACATCCTGAATCAGAAAAA
TTATACATAAATACCGTTGATTTGGGAGAACAAAATTACAGAATGATAGCCTCTGGATTA
AATGGTAAAATTCACACCGACGAGATGGTGCAGGGTTTAGTTCTCGTATTTGCTAATATC
AGACCTAAGAAATGCGTAGATTTTAAATCTCAGGGTATGTTACTGTGCGCTTGCGATGAT
GAAATGAAATAAATTGAACTTATAAGGCCACCTGATGGATCTCAAGTTGGTTAAAGAGTG
TAACTAGCAGGAAACCCTATAAAAGGAGAGCCTCTCCCCGAAGAATAAAAACCTGTGCTC
ACGAGCAGGAAAAAGTATGCTTAAAAACTTCTCGAATTATTGAAAACAGATAATGAAGGG
GCTGCAACATACGATGGCGTTAGCTTGGAATCACCCACAGGCAAGTTAAAGTGCAAAACG
TTAAAAAATATGAAGATTCTATGA


>Contig5743.0.g73(protein)
MKSRNHLTINQDWSKLSVINSTQELYTPQIGLKKKFLDAKKLSLTPRTNQTMDEKWKVFE
RCDLRVGKIVKSEPHPESEKLYINTVDLGEQNYRMIASGLNGKIHTDEMVQGLVLVFANI
RPKKCVDFKSQGMLLCACDDEMKQIELIRPPDGSQVGQRVQLAGNPIKGEPLPEEQKPVL
TSRKKYAQKLLELLKTDNEGAATYDGVSLESPTGKLKCKTLKNMKIL