Identifiers and Description

Gene Model Identifier

Contig2241.0.g81

Standard Name

AIMP1c

Aliases

Contig2241_0_g81

Description

Putative tRNA binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01588 ) Putative tRNA binding domain
  • ( pfam00043 ) Glutathione S-transferase, C-terminal domain
  • ( pfam06459 ) Ryanodine Receptor TM 4-6
  • ( pfam05661 ) Protein of unknown function (DUF808)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005585901.9998323414791308e-36TRNA binding domain containing
protein
SGDYGL105W1.0000422327488734e-24ARC1 SGDID:S000003073, Chr VII
from 307437-308567, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2241.0.g81(coding)
ATGGAGTTATTTGTATCTTCAAACACTAGCGAGTCCAAGCTCTCCTTAACTGTGGAGTTG
TTCTCAAACTATCTCAGAGCCACCCAGAGAAAGATGGTTAACATGACCCCGCTCACCAAG
CTCACTCAGCAATCACTCAAGATCAACGATCTTCCACTCTTGATTAAAAGCACAAGTGCA
GGTCCAGGCTTAGAGGAGCATCCAGTTCAAACTGCTAATCCAGCTTCAATTATGTTGGAA
ATCGCTAGATCAGTTTATCTTGAAGAGGTTATCTTTGGAAAGCCAGATTCAACTACCAGA
CTTGAGATCTTAAGCATGATTGAATTGGCAACAAGAATGTCACCAGAAGACTTGATTAAG
CATTTGAACAGTCACTTGGAACTCAGAATGTTCCTTGTTGGTCACTCAATCACTGCTGCT
GATATCACTACTCTTGCCCACATCATTGAACATTTCAATTCTATTTCTGACTACGATAAG
ATACAGGTCCCTCACGCCTTCAGATGGATTGATCACGTGCAACATCTCCCAGGAATGTTT
GAGCAAGTTCAACAGCGCAATCTCTTAGTGGGCTTCCCAGATGAGAAGAACGCAGAAGCA
CCAAGCAAGAGTTAACTCAAAAAGCTTGCCAAGATTCAATACGCCAAGGAAAAGAAGGGA
GGAGCCCCAGTTGGCAAAGAGGAAGTTAAGCATTAGGGTAAACCTAAGGAAGCTGTGGAT
TCAACTTTGAGCACTCAAGTCTCTCAAAATGAGGAGCAAAAGAAACCTTAACAAGAAAAG
AAGCCAAAGTAATAATAGCAATAGAACTAGAACAAGAAAGCTCCCGCTAAAAAGGCCCCA
GAGGAGCAAATCCCAGATCTTTCATAAATGGATATTAGAGTTGGTAAAATTGTTGAAGTA
TGGAAAAACCCTAACTCTGAAAAGCTCTACAACGAAAAGATTGATATTGGAAATGGTGAA
ATCAGATGTATCGCTTCTGGACTTCAAAAACTAGTGAAGATTGAGGATATGCAAGACTCA
CTTTGCGTTGTATTGTGTAACTTGAAACCAAAGAAGTTGGCTGATTACATGTCACATGGT
ATGGTTCTATGTGCTGAGACACCTGAGAGAGACGTAGCTGAACTTGTTTAACCACCTGAA
GGATCTCAACCAGGAGACTTAATCACCTTCGCTGGTTACGAGAGACGCCCACCCGATGCT
CTTAACCCCAAGAAAAATCCATGGGACAACGTTGCTCCAAAATTAAACATTGATGCTAAC
GGTATCGCCAAGTACGATGATATTCCATTCAATGTAGAGGGCAAAGGTGTTTGCACAGCC
AAATCAATCAGAAATGGAGGTATTCATTGA


>Contig2241.0.g81(protein)
MELFVSSNTSESKLSLTVELFSNYLRATQRKMVNMTPLTKLTQQSLKINDLPLLIKSTSA
GPGLEEHPVQTANPASIMLEIARSVYLEEVIFGKPDSTTRLEILSMIELATRMSPEDLIK
HLNSHLELRMFLVGHSITAADITTLAHIIEHFNSISDYDKIQVPHAFRWIDHVQHLPGMF
EQVQQRNLLVGFPDEKNAEAPSKSQLKKLAKIQYAKEKKGGAPVGKEEVKHQGKPKEAVD
STLSTQVSQNEEQKKPQQEKKPKQQQQQNQNKKAPAKKAPEEQIPDLSQMDIRVGKIVEV
WKNPNSEKLYNEKIDIGNGEIRCIASGLQKLVKIEDMQDSLCVVLCNLKPKKLADYMSHG
MVLCAETPERDVAELVQPPEGSQPGDLITFAGYERRPPDALNPKKNPWDNVAPKLNIDAN
GIAKYDDIPFNVEGKGVCTAKSIRNGGIH