Identifiers and Description

Gene Model Identifier

Contig1758.0.g107

Standard Name

AIMP1a

Aliases

Contig1758_0_g107

Description

tRNA synthetases class I (W and Y)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00579 ) tRNA synthetases class I (W and Y)
  • ( pfam05596 ) Taeniidae antigen
  • ( pfam13376 ) Bacteriocin-protection, YdeI or OmpD-Associated

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001499808.000025211074901e-158hypothetical protein
SGDYGR185C1.0000633497921574e-36TYS1 SGDID:S000003417, Chr VII
from 867520-866336, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1758.0.g107(coding)
ATGTCAATCTCACCATTACACGGAGGATTAGTCTTTTAAGAAGATCAATAAGTTTCAAAC
AAGAGACCTCAACATGTTTCTTAAGAAGAATCAAAGACAGTCAAGTCATCAATCGGAGGA
AATGACTTGAACGAGAGAGATATCAATGAGTTCTTCAATCCCAGACCAAGTGAACTAAGT
CTTGATGAGAGAGTTAAATTAGTGTTGGAAGTCGGTGAAGAAGTCATCATGCCCGAGGAA
ATCAAGAATCTATTGGCCAAGAAGCAACTATGGAATTGCTATGATGGATTTGAGCCCTCT
GGAAGAATGCACATCGCTCAAGGTATCATGAAGTCAATCAATGTAAACAAAATCACCAAA
GCTGGTGGTGTGTTTATTTTCTGGGTTGCAGATTGGTTCGCACTACTCAATAACAAGATG
GGAGGTGACCTCGAAAAGATTCAAGTTGTCGGTAGATATTTCGTTGAAGTCTGGAGAGCT
GCTGGCATGAACCTGGCTAATGTGAAGTTCCTGTGGGCTTCAGAGGAGATCAACAAGAGA
CCAGATGAGTATTGGTCCACTGTCATTGACATCTCAAGAAAAGCAAGTATTTCAAGAGTA
AAGAGATGCGCCACCATCATGGGAAGAAATGAGGGAGATGATATGCCAGCTGCTCAAATC
ATGTATCCATGCATGCAATGTGCAGATATTTTCTTCTTGAAGGCTGATGTATGCCAATTG
GGTATGGATCAAAGAAAGGTTAACATGCTCGCCAGAGAGTACTGCGATGATATCAAGAAA
ACCGATAAGCCAATCATAGTGTCACATCATATGATGATGGGATTGAAGGAAGGCCAAGCA
AAGATGTCTAAAAGTGATCCAGATTCCGCTATTTTCATGGAAGATACTGTTGAAGATGTC
AATAGAAAGATTAAGAAGGCTTTCTGCCCACCAGCAATTATTAAAGATAACCCAATTGTG
GACTATGTTAGATACATTATCTTTGAGAAATTCGATACTCTTGTGATTAGAAGAAACGCA
TAGAACGGTGGTGATCTTTTCTACAGCAGCTTTGAAGATTTTAAGACTGACTATGAGCAA
GATAAGATACATCCAAGTGATGTCAAGATTGCAACAGCTCAATACATTAATGAATTATTG
CAACCAGTCAGAGATCACTTTGAAAAGGATCCATATGCTAAGAAGCTTCTTGATACCATT
AAAAAGTGGCAATAAGAGATGGCTGACAAGGGTGTCGCAACTAAATGA


>Contig1758.0.g107(protein)
MSISPLHGGLVFQEDQQVSNKRPQHVSQEESKTVKSSIGGNDLNERDINEFFNPRPSELS
LDERVKLVLEVGEEVIMPEEIKNLLAKKQLWNCYDGFEPSGRMHIAQGIMKSINVNKITK
AGGVFIFWVADWFALLNNKMGGDLEKIQVVGRYFVEVWRAAGMNLANVKFLWASEEINKR
PDEYWSTVIDISRKASISRVKRCATIMGRNEGDDMPAAQIMYPCMQCADIFFLKADVCQL
GMDQRKVNMLAREYCDDIKKTDKPIIVSHHMMMGLKEGQAKMSKSDPDSAIFMEDTVEDV
NRKIKKAFCPPAIIKDNPIVDYVRYIIFEKFDTLVIRRNAQNGGDLFYSSFEDFKTDYEQ
DKIHPSDVKIATAQYINELLQPVRDHFEKDPYAKKLLDTIKKWQQEMADKGVATK