Identifiers and Description

Gene Model Identifier

Contig22279.0.g71

Standard Name

AIG1

Aliases

Contig22279_0_g71

Description

50S ribosome-binding GTPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001555700.000050024383570459175hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22279.0.g71(coding)
ATGGTATAAGCAAAACCTCCCATCGATCCCTAAGTTAGACCAAGGAGAAATATGGTAGAA
CCGAATCCTTTCAGCGATCCTTAAGATAGACCAAGGAGAAATATCTTCGTAATTGGTACC
ACAGGATCAGGCAAAAGCAGTCTAATTAACAATATTATTGGAAGAATAGAGGCGGAAGAA
GGTCATAATGGTGATTCATGTACACAGAAGGTTAAGTCATTTGAATGCAATTTTGAAGGA
ATCCCAGTTAGACTTTTTGACACCAAGGGATTCAACGATACAGATGGAATTCTGAATAAA
AATTAAGAAGAGTTGATTAAAGTGTAGCGACTCTTCTTAAATAAGACACTGCAAAATTCA
ATTTGCATTAAACCGTAATTTCTCGAAGATCTGGATAAAGAAATTTAGAAAACTTCATAA
TATATACGTGAAAAAGAAGCTTCACCAGTTATGAAAAAAATGAGAAAATAGGGCAGTTAA
TTTAAAATATATACCCACAAAGCTGAACTTAGAGAAAATAATTAAGAAGAGGAAAAAAAG
GAATAGCCAAAATATTCAATTTAAAATCTTGGAGGGTTAACTGGAGGCACTGCTGGATTT
GTCGGTGGATTTGAATTAGGAGCAGGTCATGGAGTCATCTTCGGACCTGGTGGAGTAGTT
GTTGGTGCGTTCGTAGGTGGTTTATTAGGATTTCTTGGAGGAGCTGTTGCTGGTGGGATA
ACTGGAGATCTTGCATAAAGAACAATAAATAGTACTCTAAATTATTTTACATCTAAGCCT
ACCTGGAATACTTCTTCAAAAGTGGAAGTGTATATTGCAAAAGAAGGAAATGTAATAAAA
GCAGCTCCAAAGTTTGATTCAAGTGGCAATGGAAGTATCAGAAACATTCGCTGGGAAGCT
AAAAGTATTATTTTTGAAATTGTTGTTGAAAGTAATGAATTTTCTACTGTAATGGAATCA
ACTGAAGAGTGGGAGCATTCTGTTTAAAGTGGTGATAAAGAATATAAAAAATCTATAGCC
GAATACAAAAGATGCCTTATGGAAAAACTCACGTCTTTGGCAGAATAAAGGAATAGAGAA
TCAGACTTTGACGCAATAAAGTACCTAATAGATTTGAGAAGAATACCTAAAAACTAAGAA
ATACCTAAAAAATAAGAAGTACCTTAAAAATAAGAAGTACCTTAAAAATAAGAGAGTTAT
TGCAGCATTTTTTGA


>Contig22279.0.g71(protein)
MVQAKPPIDPQVRPRRNMVEPNPFSDPQDRPRRNIFVIGTTGSGKSSLINNIIGRIEAEE
GHNGDSCTQKVKSFECNFEGIPVRLFDTKGFNDTDGILNKNQEELIKVQRLFLNKTLQNS
ICIKPQFLEDLDKEIQKTSQYIREKEASPVMKKMRKQGSQFKIYTHKAELRENNQEEEKK
EQPKYSIQNLGGLTGGTAGFVGGFELGAGHGVIFGPGGVVVGAFVGGLLGFLGGAVAGGI
TGDLAQRTINSTLNYFTSKPTWNTSSKVEVYIAKEGNVIKAAPKFDSSGNGSIRNIRWEA
KSIIFEIVVESNEFSTVMESTEEWEHSVQSGDKEYKKSIAEYKRCLMEKLTSLAEQRNRE
SDFDAIKYLIDLRRIPKNQEIPKKQEVPQKQEVPQKQESYCSIF