Identifiers and Description

Gene Model Identifier

Contig7159.0.0.g21

Standard Name

AGFG2

Aliases

Contig7159_0_0_g21

Description

Putative GTPase activating protein for Arf

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01412 ) Putative GTPase activating protein for Arf
  • ( pfam05793 ) Transcription initiation factor IIF, alpha subunit (TFIIF-alpha)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7159.0.0.g21(coding)
ATGCATAAAGTCAAAGGAATAGGCATGTCCAATTTCACTGACAAGGAAGCTGCAACTATT
GCTGAGAAAGGAAATAAGAATGTGTAAGAAACTTTAATGGGTGATTACTCATAAAAGTTG
TACCCTGAACCTGACAAGCGTGATTTGATAAAAATGAAGGAGTTTTTCAAGCTAAAATAC
ACTTAAAAAAGATTTGAAAAGAAGTCGGATAACTCAGACTCAGATGACGATAGCGATGAT
GATAAGAAAAAGAAATCGAAGAAAACTAGTTCAAAGAGCACCAAAGATAGCAAAAATGAT
AAGAAAAAATCAAAGAAGAGGAAGGATTCATCAAGTGAAGAAAGCGAGAGCGATAGTGAT
GGAGAGTCTAAGAAAAAGAAACCTAAGAAGGAAGAAGAGAAAGCAACTGGCAAATTTTTA
CCTGCTCCAGGTGGTAAAAAATTAGCAGCTCCCATTTCTTCCAACACAAGTTCAAATGGC
AGGCAGCAGGAATAGATTAAAACTTAAATTGTAAATTCAAATCCACCATCAAAAACAAAT
AGTACAACAGTAGATTTACTTGATATTCTCAGCGAATAACCTCCAACTTAAGCACCCCAA
AACTTTAATTAACATGGAAATGTCTAATAATAGAATTAAGCAGTTGATAATAATGGTTGG
AGTACATGGGCTACATTTGACAATAATAATGGTTAATAGTAAACCTAGCAGCCGGTTGTA
AACCAGCAATCACGAAACTAATAAGAGAGCTTGATTTAAAATTTATCAAATCTCTATCCA
AACCAAACTCAGCCCCCAATCACCAAGACTAACTTTATTCCTGCAGGCTTAACTAAACCT
AACTTCGTTTCAGAAGATCCATTCCAAGATATCATTTAAGAGTAACAACACTAGTAATGG
CTTCATAAGTAGCAATAAGCTTTAGCTTAAAATTAACAGCAATAATAGCAGCATCATGTG
CAGCCTGCACAACAATAGTAATAATTTGCTAACCCAGCAACTATGCATTAATAATTGCCA
GGTATGGGAGGATTTGGAAGTGGTGTACCCTAATAATAACAATAGCAACCTCAACCAAAT
CCCTAGGCTATGCAATAACAGCAATAACTAATGTCCATGCAAGCATAGATGGCTTAATTG
ATGCAGCAATCACAAACCAACCCCAATCAGTAAACCATTGCTATGATGGCTCAAATGCAG
CAAATGATTATGATGATGTAAAACATGATGAGTTCAAGTATGGGAGGAGGAGCAGCTCCT
GGTGGACAGCCTGGCATTAATGCATAGTAACTCTAGCAGTTAAAGCTCCAGCAAGAGCAG
CAAGAACAAATGAAGAAGCATAACCCTCAAGATAACATGTTCTCTGACTTATTCAAGTCC
GCAGCAAGCCAACCCCTTCACCAAGGAAAAGACATGCACCACCACGACAATGGAAGTTAG
TTCAATCCATTCGGCAGTAACTCTAACATGAGTTTGGGAGGAAATACTGGCGGTCCTTAA
ATGTAACCAATGAGCGGCTTCAACAACAACGGAATGCATCAATAAGCCAATGTACAGTAA
CAAAGTAGTTTCAATCCATTTGGAAATGCAGGCCCAAGTATGAGCAGCTAAACTTCAGCG
TCCTCTAATAATCCATTTGATATGTTCTGA


>Contig7159.0.0.g21(protein)
MHKVKGIGMSNFTDKEAATIAEKGNKNVQETLMGDYSQKLYPEPDKRDLIKMKEFFKLKY
TQKRFEKKSDNSDSDDDSDDDKKKKSKKTSSKSTKDSKNDKKKSKKRKDSSSEESESDSD
GESKKKKPKKEEEKATGKFLPAPGGKKLAAPISSNTSSNGRQQEQIKTQIVNSNPPSKTN
STTVDLLDILSEQPPTQAPQNFNQHGNVQQQNQAVDNNGWSTWATFDNNNGQQQTQQPVV
NQQSRNQQESLIQNLSNLYPNQTQPPITKTNFIPAGLTKPNFVSEDPFQDIIQEQQHQQW
LHKQQQALAQNQQQQQQHHVQPAQQQQQFANPATMHQQLPGMGGFGSGVPQQQQQQPQPN
PQAMQQQQQLMSMQAQMAQLMQQSQTNPNQQTIAMMAQMQQMIMMMQNMMSSSMGGGAAP
GGQPGINAQQLQQLKLQQEQQEQMKKHNPQDNMFSDLFKSAASQPLHQGKDMHHHDNGSQ
FNPFGSNSNMSLGGNTGGPQMQPMSGFNNNGMHQQANVQQQSSFNPFGNAGPSMSSQTSA
SSNNPFDMF