Identifiers and Description

Gene Model Identifier

Contig10223.0.1.g27

Standard Name

ADDL2

Aliases

Contig10223_0_1_g27

Description

ATP dependent DNA ligase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01068 ) ATP dependent DNA ligase domain
  • ( pfam04679 ) ATP dependent DNA ligase C terminal region
  • ( pfam04675 ) DNA ligase N terminus

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008652402.9990539278805726e-74DNA ligase I, ATP-dependent
SGDYDL164C2.000597631390999e-64CDC9 SGDID:S000002323, Chr IV
from 167254-164987, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10223.0.1.g27(coding)
ATGTCTGTAGCTCAAAATATCATTCACTAGAGCTTAATAAAGACATTTTCTATTAGTTAG
GCAGAGTTGAGGAAAATGGTTGTCAGTCAGGGAGACTATGGAAATATAGCGTAAAAATTG
TTTACTGAAAAGAATCAGTAAAAACTACAGCAGAAACAACAATAAGAAAAAAACAATATA
TCTCAAAACACTTTAACACTAGAAGATGTTGTGAAAGTATTTGTGTAGTTAAACGATATA
AAAGGAGAGGACTCTATTATCGGGAAGATATCTGAAATATCAGAGCTTTTGAATAAATGC
TAAAATGAAATTGAAATTAAGTTCATAGTCAGATCCCTTGATAAGGGTTTGAGAATAGGA
ATATCTAGACCATCGGTAGAAGCTTGCCTTCTAAAACTCCTTAATGAGGGGGAGATTAAC
AATGAATTTGTCGACGAGTATGAGAACACAATATTTGGATACAAGATTTATAATAACTCT
TCATTTGGAGATCAAGGTTTAAATGAAAATAGTGAAGAGAGTTAAGAATCAGAAATTAAG
CCAAAATAAACTGGGAAATTATTACCAACAAATGTTCCTTTGAAACCTATGCTGGGGAGA
CCTGCCAAAGATTTTGAAGAAGTTTTGAAATTGACTTCAAAATTTCGCAAAAACTAAAAC
GATTACTTATTAGCAGAGTATAAATACGATGGAGAAAGAACCTAGATTCATTTTGATGGT
GAAAAAGTGATGATGTACAGTAGAAATTTCGATACCTAAAATTAAAAATTTTGGAGATTA
AACGAACTCTTAACTACATATTTTCTTGAAAGGAAAAAATAAGGGAAAATCGATAGATGT
ATACTAGATGGAGAAGTGGTATATATTGACAATAAAACTAATAAGTACATGCCTTTTTAA
AACATTGAACGCACTTTATAAATGAAGAGTGAAGATCCTCTTGCGTAAATTGAAGTTGAT
CAGCTTCAAGAAATATCTACGAGGCCGTGTGTTGTGCTATTTGATGTTTTGGCTTTGAAT
AAAAAAGATTGTATAACTGAGAACATTTTAAAGCGAAAAGAAATTCTCAAAGAGACTTTC
AGTGACGAGCCTAATTTACTATAACTTGGATAATATCATGTGTTAAGTCTAGACGACCCT
CTCTTTGATAGAGAGGAAAAAAAAGATATTGAACCTTCAAAGTAAAAGAAGAAAGCATCT
AAGAAATAAGATGACGAAGTTGTAATAAAGCAAACTATTCTTGAAGCTAATCCACATTTA
TTAGTAGTTATGCTAAAAGTTAACGAATTAATGTTATAATCACTTAATGATGACTGTGAG
GGCTTAATTTTCAAATCAGCCAATGATAATACATATTACGATATCTCGGGTAAAAGATCC
TAGTAGTGGGTTAAATTGAAGCACAAACTCAATGATAATAAAGGAGAGATGCGAGATACT
CTGGATTTAATTCCGATTGGAGCTTATTATGGTCTTGGCAGAAGGACAGGGACATTTGGA
GCATATCTAATCGGGGCATATAATAGAGAATACAAAAATTTCGAAGCAGTTTGTAAATTA
GGTACAGGATTTAAAGACAGTGATTTAAAATTACTACATGAAAGAGTTACTCCACTCTTA
ATGGAAGATAAACCTACTACTTTTAGAGTGAGTTCCACTATAAAACCTGATTATTGGATT
AATCCTAAGTATGTTTGGGAAATTGGTGCTGATTAATTCTCGTTGAGTAAAACATATACA
ATTGGTAAAGGTACTTTGAAAGATATGAACGGAGTGCTTTTGTAAGATGCTGGCTTATCT
CTCAGATTCCCTAAATTTATTCGTGAGAGACCAGACAAGGAAATTAAATTAGAAATTAAA
AAGGACAAAACAGATCATTTCTATGTTTAAGATTAAGAGATAGGTACTGAAGTTGGAGAG
ATACTGAGAATGTATAAAATGGACATTGAAAGCATGCAAAAAATTAAAGATAGTGATACA
AAATGA


>Contig10223.0.1.g27(protein)
MSVAQNIIHQSLIKTFSISQAELRKMVVSQGDYGNIAQKLFTEKNQQKLQQKQQQEKNNI
SQNTLTLEDVVKVFVQLNDIKGEDSIIGKISEISELLNKCQNEIEIKFIVRSLDKGLRIG
ISRPSVEACLLKLLNEGEINNEFVDEYENTIFGYKIYNNSSFGDQGLNENSEESQESEIK
PKQTGKLLPTNVPLKPMLGRPAKDFEEVLKLTSKFRKNQNDYLLAEYKYDGERTQIHFDG
EKVMMYSRNFDTQNQKFWRLNELLTTYFLERKKQGKIDRCILDGEVVYIDNKTNKYMPFQ
NIERTLQMKSEDPLAQIEVDQLQEISTRPCVVLFDVLALNKKDCITENILKRKEILKETF
SDEPNLLQLGQYHVLSLDDPLFDREEKKDIEPSKQKKKASKKQDDEVVIKQTILEANPHL
LVVMLKVNELMLQSLNDDCEGLIFKSANDNTYYDISGKRSQQWVKLKHKLNDNKGEMRDT
LDLIPIGAYYGLGRRTGTFGAYLIGAYNREYKNFEAVCKLGTGFKDSDLKLLHERVTPLL
MEDKPTTFRVSSTIKPDYWINPKYVWEIGADQFSLSKTYTIGKGTLKDMNGVLLQDAGLS
LRFPKFIRERPDKEIKLEIKKDKTDHFYVQDQEIGTEVGEILRMYKMDIESMQKIKDSDT
K