Identifiers and Description

Gene Model Identifier

Contig17016.0.g67

Standard Name

ADDL1b

Aliases

Contig17016_0_g67

Description

ATP dependent DNA ligase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01068 ) ATP dependent DNA ligase domain
  • ( pfam09518 ) HindIII restriction endonuclease
  • ( pfam11800 ) Replication protein C C-terminal region

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003928502.9998512931988133e-83ATP dependent DNA ligase domai
n containing pr...
SGDYOR005C0.00020003864201578029DNL4 SGDID:S000005531, Chr XV
from 337343-334509, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17016.0.g67(coding)
ATGAGAACTAAACTTCAAGCCTAACCACAGGATAAAGTGAATTAAATTTCTAAGAATTCA
AAATAAATATAAAGAGATTCTTAACCGTCAAAAAGTACCAGTACTTCCCCAAAATCTAGT
CCAGAGAGTCAAAATAAATAGTCCACAGTAACAAAGGTCACCAAGAAGAAAGAACTAAAA
CCCCCAAAGGCACCCAAGCCCGAGAAAAAAGAGTCAATAAATTTGAAAGTTCTGCTTGCA
AATACCTACGATCCTGATAAGCTACCAGATCCCACAGGATGGTACATGTCTGAGAAACTC
GATGGAGTGAGATGTTACTGGGATGGAAAGGGCAATCTATATTCTAGGAATGGAAAAGTA
TTCTACCCGCCAAAGTATTTTGTAGATGAACTACCCTAAGGATTTGAACTGGATGGGGAG
CTATGGACCAAGAGAGATGATTTCTAGAAATGTGTAAGTATTGTCAAACGTCAAGATGAG
AATGATGAGTGGAAGTCAATTAAGTATATGATCTTTGATGCTCCAGGAATGAAGGAATCA
GGATTCAGTGAGAGATACAAAAAGATTTGTCAAATTGTTTCAAAGAGCAAATCGCAATAT
CTAGTAGCTTTGGAACATCGTATATGTGAGGGGAGAGAGGATCTGATGTAAGAAATGGAA
AGAATCACAAGTGCTGGAGGCGAGGGAGTTATGCTTAGAGAACCGAATAGTCTATATGAG
CAAAAAAGAAGCAACAATTTACTGAAAGTTAAGAATTTCGATGATGCTGAAGCATTAATT
ATTGGGCATGAACCTGGAGAAGGAAGATTGAAGGGACTTCTAGGTGCTCTAAGAGTTAGG
GATGATGAGGGAAAAGAATTCAAGATTGGCTCTGGGTTTAATGATGCTTAGAGAGCAGAC
CCTCCTAAAATTGGTCAAAGAGTAACTTTCAAATATATGGGGAAAAGTAAAGGTGGGATA
CCAAGATTTCCAATTTATCTTAGAGTACATCTAGGTTTATGA


>Contig17016.0.g67(protein)
MRTKLQAQPQDKVNQISKNSKQIQRDSQPSKSTSTSPKSSPESQNKQSTVTKVTKKKELK
PPKAPKPEKKESINLKVLLANTYDPDKLPDPTGWYMSEKLDGVRCYWDGKGNLYSRNGKV
FYPPKYFVDELPQGFELDGELWTKRDDFQKCVSIVKRQDENDEWKSIKYMIFDAPGMKES
GFSERYKKICQIVSKSKSQYLVALEHRICEGREDLMQEMERITSAGGEGVMLREPNSLYE
QKRSNNLLKVKNFDDAEALIIGHEPGEGRLKGLLGALRVRDDEGKEFKIGSGFNDAQRAD
PPKIGQRVTFKYMGKSKGGIPRFPIYLRVHLGL