Identifiers and Description

Gene Model Identifier

Contig22262.0.g6

Standard Name

ADDL1a

Aliases

Contig22262_0_g6

Description

ATP dependent DNA ligase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01068 ) ATP dependent DNA ligase domain
  • ( pfam09531 ) Nucleoporin protein Ndc1-Nup
  • ( pfam09726 ) Transmembrane protein
  • ( pfam10510 ) Phosphatidylinositol-glycan biosynthesis class S protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003928502.0001925730668994e-91ATP dependent DNA ligase domai
n containing pr...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22262.0.g6(coding)
ATGAACAGCGTTTCATCTCATAAAAATTATAACCCTTTTGTTGGAGCTAGTTCGAGCGAT
ATCTTAGTTGGACCATATGAACTTTTTAAGGAAAATTCTAATGGCAAGTCATGCAACAGA
ATCACAATGGCAATTACAGATAATTTCTCAGTTTAAACTAGAAAGTACATTAACTAGAAA
CATTTAACCACAGAAAAAGAAAACCATTAAAGTTTGGAAGATGCTATGGACTACCTAGAA
TAGAAATTAACTATCCATAGAAAATCAGATTTTTATGAAAAGCAAGAATTGAATGATAGG
CAAAAACAAAAGAAGAAGGAGCAAGAAGAAAAGAAGTAACAAGATAAGATAGGGAAGAGA
CTAAACAGAGATGCATCAGCGGATTCACAAACTAGCTAAACTGATGCTAAAAAGAGACAG
AATTTGGGAGCTACCGATCAGAACTAGGCATCTAATCACGGCAGTGATTTGATAAAATCC
TCAGTCTCAACTTCTTCAGGTAGTGCCAACAAATAACAGGAAGAAAAGAAGAAGTCTGCT
AAATCATATGAAGAGGAGAAGAAGCAATCATAAGCAGATCACTTGTCTCAAGAGCCAACT
AGAAGGTCAGCAAGAAATTACGGCAAGGACTAGATAGATTATAACATTGATCATATTCTT
GCTGCAGCAGATGCAGCTGAAATGGGCGATATTGATAATGGAACACTGGGAGGAGGATGC
ATCAATGTGATGCTTGCTTAGAGTTATGACCCAGAGAAGAATGATCCCACAGGCTGGTTA
ATGTCTGAGAAACTAGATGGAGTAAGATGTTACTGGAATGGTTCTGCCATGTATACAAGA
AACAAGAACCTTTTCTATCCACCAGACTGGTTTAAGGATCAACTCCCAAAGGATTTATGT
CTCGATGGAGAATTGTGGACAAAAAGAGGTGATTTCCAGAAAATTGTTAGCATTGTAAGA
CGTTAAGATAAGAATGAAGAATGGAAGAACATAAAGTACATGGTCTACGATGCTCCAAAG
GCAAAGGGAAACTTCAAGTAAAGACTCAAGAAAATGCATGAAGTCATTGATGTACTTAAC
TCTGATTATATCAAGGTTCACCCTCATGTAATATGTAAAGACGTGGAACACCTTACTCAA
GAATTAGATAAGGTGACTGCAGCTGGAGGAGAGGGCATGATGATCAAAGATCCAAATAGC
AAATATGAAAACAAGCGCAGTGAGCTCCTATTAAAAGTCAAAAAGTTTGATGATGCAGAA
GCCACAGTTATAGGTCATTAGAAAGGAACTGGGAGATGCAGTGATATGTGTGGAGCCATT
TTGATGAGAGGAGATGATGGCATTGAATTCAAAATTGGTTCAGGCTTTAACGATGCTTAA
AGAAGGAAACCACCCAAACTAGGAGCTAGAGTCACATATAAATATATGGGGAAGAGTAAT
GCTGGGAAACCTAGATTCCCTATTTTCATGAGAGTTCATCCAGGCATGTGA


>Contig22262.0.g6(protein)
MNSVSSHKNYNPFVGASSSDILVGPYELFKENSNGKSCNRITMAITDNFSVQTRKYINQK
HLTTEKENHQSLEDAMDYLEQKLTIHRKSDFYEKQELNDRQKQKKKEQEEKKQQDKIGKR
LNRDASADSQTSQTDAKKRQNLGATDQNQASNHGSDLIKSSVSTSSGSANKQQEEKKKSA
KSYEEEKKQSQADHLSQEPTRRSARNYGKDQIDYNIDHILAAADAAEMGDIDNGTLGGGC
INVMLAQSYDPEKNDPTGWLMSEKLDGVRCYWNGSAMYTRNKNLFYPPDWFKDQLPKDLC
LDGELWTKRGDFQKIVSIVRRQDKNEEWKNIKYMVYDAPKAKGNFKQRLKKMHEVIDVLN
SDYIKVHPHVICKDVEHLTQELDKVTAAGGEGMMIKDPNSKYENKRSELLLKVKKFDDAE
ATVIGHQKGTGRCSDMCGAILMRGDDGIEFKIGSGFNDAQRRKPPKLGARVTYKYMGKSN
AGKPRFPIFMRVHPGM