Identifiers and Description

Gene Model Identifier

Contig18297.0.g102

Standard Name

ADAT2

Aliases

Contig18297_0_g102

Description

Cytidine and deoxycytidylate deaminase zinc-binding region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00383 ) Cytidine and deoxycytidylate deaminase zinc-binding region
  • ( pfam14437 ) MafB19-like deaminase
  • ( pfam14439 ) Bd3614-like deaminase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJL035C1.9998323414791308e-36TAD2 SGDID:S000003572, Chr X f
rom 381001-380249, Genome...
T. thermophilaTTHERM_002188990.00000000019994075865167896conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18297.0.g102(coding)
ATGGATTAATTGGAGTAAGTGAGTCAATTGCAGCAGCAAATAATTTAACCGATGGAAAAT
CAAACCAAAGATGAAAAACTAATGATGATGGCTGTTGAATAGGCTTAAATTGCTTTAGAT
GTTGGAGAAGTACCTGTCGGATGTGTATTTTATCATGAACCTTCAGATAAAGTCATAGCT
AAATCTCATAATTTGACAAATCAAACAAAAAATGCAACCACTCACTGTGAAATAAACTGC
ATTAATTAGTTGAGTGATAAAAATGAACAAGATTTTTTAAAGGAATGCACTCTTTATGTG
ACAGTTGAGCCATGCATTATGTGTGCCTATGCTTTAAACCTTGCAGGAATTAAAAATGTA
GTGTTTGGATGTGAGAACGATAAATTTGGAGGAAATGGATCTATACTGTCTTTACATTAA
TTGAATAATAAGTATCACATTAAGAAGGGAGTGTTGAAAGACCAAGCAATTAACCTATTA
CAGAGATTTTATGAACATGGAAATGAAAAGGCTCCTGAAAACAAAAGATAAAGGAAAATT
TGA


>Contig18297.0.g102(protein)
MDQLEQVSQLQQQIIQPMENQTKDEKLMMMAVEQAQIALDVGEVPVGCVFYHEPSDKVIA
KSHNLTNQTKNATTHCEINCINQLSDKNEQDFLKECTLYVTVEPCIMCAYALNLAGIKNV
VFGCENDKFGGNGSILSLHQLNNKYHIKKGVLKDQAINLLQRFYEHGNEKAPENKRQRKI