Identifiers and Description

Gene Model Identifier

Contig8489.0.g83

Standard Name

ACO1b

Aliases

Contig8489_0_g83

Description

Aconitase family (aconitate hydratase)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam00330 ) Aconitase family (aconitate hydratase)
  • ( pfam00694 ) Aconitase C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000374709.997093137033517e-262aconitate hydratase 1 family p
rotein
SGDYLR304C1.9999167998962255e-60ACO1 SGDID:S000004295, Chr XII
from 737548-735212, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8489.0.g83(coding)
ATGGAGAAAGCTAATCCCTTCCAAAACGTGTTGCAAGAATTGCAAGTTGAAGGCCAGTCC
TACAAATACTACTCACTTCCTGCTCTTAACGATCCAAGAGTAGAGAAATTGCCATTCTCA
GTTAGAGTGTTGCTTGAAAGTGCACTTAGAAATTGCGATGAATTCAATGTTAAATCCACT
GACATCGAGACCATCTTGAACTGGACCTCTAGTTCAGAATAAGATCTTGAAATTCCATTC
AAACCAGCAAGAGTACTTCTTCAAGACTTCACAGGTGTACCAGCTGTTGTTGATTTGGCA
GCAATGAGAGACGCCATGACCAGATTAGGAGGTGATGCCGAAAAGATTAACCCCTTGTGC
CCAGCTGACTTAGTCATTGATCACTCAGTACAAGTAGACGTAGCAGGTACTGCTGATGCC
AGAGAAAGAAACGAAGAATTAGAATTCTCAAGAAATCAAGAGAGATTCTCTTTCTTGAAG
TGGGGCCAAAGCGCTTTCGATAACTTCTTGATTGTTCCACCAGGCTCAGGAATCGTCCAT
TAAGTCAACTTGGAGTACTTGGCTAGAGTTGTCTTCAGTGTAGATGGTGTTCTATATCCA
GACTCAGTTGTTGGTACTGATTCACACACCACCATGATTAATGGTCTCGGAGTTGTCGGC
TGGGGAGTCGGAGGTATTGAAGCTGAGGCTGTTATGCTTGGTTAAACTATTTCTATGGTT
TTGCCCAAGGTTGTTGGTTTCAGACTTACTGGATCAGTCCCACCTGAAACAACTGCAACT
GATGTTGTGCTCACTATTACCTAAACTCTTAGAAAGAGAGGTGTCGTTGGTCAATTCGTT
GAATTCTTCGGACCAGGTTGCCAATCACTTACTCTTGCTGACAGAGCAACTATTGCTAAC
ATGTCACCAGAGTACGGTGCCACTATGGGCTATTTCCCAATTGATGATCAAACCATTGAT
TATCTTAAAGCTACTGGCAGAGACTCCCACAAAGTTGCCTTCGTTGAACAATACTTGAGA
GCTCAAGGTCTCTTCAGACTTTACGACGGTTCTCAACCAGACCCCCACTACTCAGGTGCC
ATCATGGAACTCGACCTTTCAACTGTCAGACCATGCCTTGCCGGTCCCAAGAGACCCCAC
GATAGAGTTGAACTCACCAACATGAAGCAAGATTTCCAAACTTGCCTCTCTAACCCAGTC
GGTTTCAAGGGTTACGCCATTCCAGAAGATAAGCATGCTCAAACCTCTAAATTCACTTTT
GAAGGTCAAGAATACGAATTATCTCAAGGTTCAGTTGTTATTGCTGCTATCACTTCTTGC
ACTAACACTTCAAACCCAGACGTCATGTTGGCAGCTGGTCTCTTAGCTAAAAACGCAGTT
GAGAAAGGTCTCTCAGTCAAGCCATACATCAAGACTTCACTCTCACCAGGTTCAGGTGTC
GTTACTAGATACTTCGAACTTGCCGGAGTAACTGAATTCTTGAACAAATTAGGATTCACT
CTATCAGGTTATGGATGCATGACTTGCATTGGAAACAGTGGAGAGTTGCACGATGTTGTA
TCTGAAGCTATTATCAAAGAAGACTTAGTTGTTTCAAGTGTTCTTTCTGGAAACAGAAAC
TTTGAAGGTAGAGTACATCCACTCACCAGAGCTAACTATCTGGCCAGTCCCCCACTTGTA
GTAGCCTACGCCCTTGCTGGTACCGTGTAAATCGACTTCGAGACCGAGCCACTCGGAAAT
GACAGAGACGGAAACCCAGTATTCCTAAAAGACATCTGGCCATCAAGAAACGATGTCCAA
AAGGTCACTCAACAAGTAATCAAGCCAGAGATGTTCCAAGAGATTTACGATAGAATCTCA
AAGGGCACTGATAGATGGAATGCTCTTGAAGCACCACAAGGCAAGTTGTTCGCTTGGGAT
GAAAACTCCACTTATATTCATGACCCACCCTTCTTCAAGGGCATGACCAAGGAAGTATAA
GAGAGAGAATCCATCAAGAATGCCTATGTGTTGGCATACTTTGGTGACTCAATTACCACT
GATCATATCTCACCAGCAGGTAACATTTCCAAGACTTCTCCAGCTGCTAAGTACTTGAAC
TCCAAGGGTGTTGAGCCAAAGGACTTCAACTCATATGGTGCTAGAAGAGGCAATGATGAA
ATCATGGCTAGAGGTACCTTTGCCAATGTCAGACTTGTGAACAAGCTTGTTGACAGACCA
GGTCCAAAGACAGTGCACATTCCATCAGGAGAGACCCTAGAAATCTTTGACGCATCAGCC
AGATATCAATCAGAAGGTCACTAACTCGTGATCTTAGCTGGTCAAGAGTACGGTTCAGGA
TCTTCCAGAGATTGGGCTGCCAAGGGACCCTTCCTTCAAGGAGTCAAGGCCGTTATTGCT
GAAAGTTTCGAGAGAATTCACAGAAGCAACTTGATCGGTATGGGAATCCTTCCACTTCAA
TTCTTAGCTGGTTAAAACGCTGAGAGTGTTGGACTTAAGGGTACTGAATAAATTACTATT
GAATTGCCATCTGAACTTGGAGTTGGCTAGACAGTCAATGTTACAACAAGCACTGGAGTC
ACCTTCGAAGCTAGAACCAGACTTGATACTCAACCAGAGGTTACCTACTACAAAAATGGA
GGTATCTTGCCATATGTCCTCAGAAAGCTCCTCCAATGA


>Contig8489.0.g83(protein)
MEKANPFQNVLQELQVEGQSYKYYSLPALNDPRVEKLPFSVRVLLESALRNCDEFNVKST
DIETILNWTSSSEQDLEIPFKPARVLLQDFTGVPAVVDLAAMRDAMTRLGGDAEKINPLC
PADLVIDHSVQVDVAGTADARERNEELEFSRNQERFSFLKWGQSAFDNFLIVPPGSGIVH
QVNLEYLARVVFSVDGVLYPDSVVGTDSHTTMINGLGVVGWGVGGIEAEAVMLGQTISMV
LPKVVGFRLTGSVPPETTATDVVLTITQTLRKRGVVGQFVEFFGPGCQSLTLADRATIAN
MSPEYGATMGYFPIDDQTIDYLKATGRDSHKVAFVEQYLRAQGLFRLYDGSQPDPHYSGA
IMELDLSTVRPCLAGPKRPHDRVELTNMKQDFQTCLSNPVGFKGYAIPEDKHAQTSKFTF
EGQEYELSQGSVVIAAITSCTNTSNPDVMLAAGLLAKNAVEKGLSVKPYIKTSLSPGSGV
VTRYFELAGVTEFLNKLGFTLSGYGCMTCIGNSGELHDVVSEAIIKEDLVVSSVLSGNRN
FEGRVHPLTRANYLASPPLVVAYALAGTVQIDFETEPLGNDRDGNPVFLKDIWPSRNDVQ
KVTQQVIKPEMFQEIYDRISKGTDRWNALEAPQGKLFAWDENSTYIHDPPFFKGMTKEVQ
ERESIKNAYVLAYFGDSITTDHISPAGNISKTSPAAKYLNSKGVEPKDFNSYGARRGNDE
IMARGTFANVRLVNKLVDRPGPKTVHIPSGETLEIFDASARYQSEGHQLVILAGQEYGSG
SSRDWAAKGPFLQGVKAVIAESFERIHRSNLIGMGILPLQFLAGQNAESVGLKGTEQITI
ELPSELGVGQTVNVTTSTGVTFEARTRLDTQPEVTYYKNGGILPYVLRKLLQ