Identifiers and Description

Gene Model Identifier

Contig1319.1.g107

Standard Name

ACO1a

Aliases

Contig1319_1_g107

Description

Aconitase family (aconitate hydratase)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam00330 ) Aconitase family (aconitate hydratase)
  • ( pfam00694 ) Aconitase C-terminal domain
  • ( pfam09693 ) Phage uncharacterised protein (Phage XkdX)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000374709.997093137033517e-262aconitate hydratase 1 family p
rotein
SGDYLR304C2.000597631390999e-64ACO1 SGDID:S000004295, Chr XII
from 737548-735212, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1319.1.g107(coding)
ATGAAAAGATTCTTCGCTAAAAAAGTCTCCGAACAAGGAAACAAATCACAATTGTAACAC
ACAGTCCAGAGATCCTTCGCCAGTGGTCCTCAGAAAAACCCTTACGCCAGCGTACTTTCA
AATCTTTCAGTCGGAAATCAAAAGTATTCTTTATATAACTTGCCAGCCTTGCAAGATAAG
CGCATCGAGAGATTGCCATACTCAATCAGAGTATTGCTTGAGTCAGCAGTCAGAAACTGC
GATGAGTTCAGCGTTAAGTAGAAAGATGTCGAGAGGATTCTTGACTGGGTCAACACTTCA
CAGAAAGACGTTGAGATCCCATTCAAACCAGCCAGAGTTATTCTTCAAGACTTCACTGGT
GTCCCAGCAGTCGTTGATTTGGCAGCTATGAGAGATGCTATTAAGAGACTTGGCGGAGAT
CCATTAAAAATTAACCCATTGTGCCCAGTCGACTTGGTCATTGATCACTCAGTTCAAGTT
GATATCGCAGGTACTAAGGATGCAAGAGAAAAGAATGAAGCTCTTGAATTCGATAGAAAC
AGAGAGAGATTCCAGTTCTTGAAGTGGGGTTCTAAAGCCTTCAACAACTTCAAAATTGTA
CCACCAGGTTCAGGTATTGTTCATTAAGTGAATCTTGAGTACTTGGCTAGAGTCGTATTC
AACCAAGATGGTCTTTTATATCCAGATTCAGTTGTTGGTACTGACTCACACACTACTATG
ATCAATGGTCTAGGTGTTGCCGGTTGGGGAGTCGGAGGTATTGAAGCCGAATCAGTTATG
CTCGGTGAGGTTATTTCCATGGTCCTACCATAAGTTGTTGGTTTCAAGTTTACAGGTCAA
CTTTAAAAGCATGTTACTGCTACAGATCTAGTCCTTACTTGCACTTAAATCTTGAGAAAG
AGAGGAGTTGTAGGAAAATTCGTTGAGTACTACGGTCCAGGTGTTAAAACCTTGACACTT
GCTGACAGAGCTACAATTAGTAACATGGCCCCAGAATACGGTGCTACCATGGGTTACTTC
CCAGTAGATGATCAAACTCTTAACTATTTAAGACTTACTGGAAGAGATGAACAATAAGTG
AAAACAATTGAGAGCTACCTCAGACAGCAAAACATGTTTGTCAAACACGATGGTTCCCAA
TAAGATCCAGAATTCTCAGGTGAAGTTATTGAGCTCGACTTATCATCAGTTCAACCATCA
CTTGCCGGCCCTAAGAGACCTCATGATAGAGTCAACCTTTCAGATATGAGAACTGACTTC
ACCACATCTCTCACCAGTAAAGTAGGATTCAAGGGATATGGTCTTCCATAAGAACACACC
AAGACTGTTGCTAAAATCAACTACTAAGGCAAGGACTACGAACTTACTCATGGTTCAGTC
GTTATCGCTGCTATTACTTCCTGTACTAATACATCAAACCCAGATGTTATGCTTGCTGCT
GGTATTCTTGCTAAGAATGCTGTTGAAAGAGGACTTTCAGTAAAGCCATATATTAAGACT
TCATTGTCACCAGGTTCTGAAGTTGTTTCAGCCTATTTCGGTGAAGCTGATGTTTAAAAG
TATCTCGATCAACTTGGTTTCACAACTGCAGGTTATGGTTGCATGACATGCATTGGAAAT
TCAGGAGAGATTCCAAAGGAAGTACAAGATGCTATTGTTGATAAAGATCTCGTTGCTGCT
GCAGTACTTTCAGGAAACAGAAACTTCGAAGGTAGAGTTCATCCAAACACCAGAGCAAAC
TATCTTGCTTCCCCACCTCTTGTTGTTGCTTACGCACTTGCTGGAAGAGTTGACATTGAC
TTCGAGAAGGAACCACTCGGCATAGATAAGCAAGGAAAAGAAGTTTTCCTGAGAGATATC
TGGCCAGATAGACCAGTTGTTACTGGTGTTTCAGGCAAGGTTATCACCCCAGAAATGTTC
AAGAAGATCTATGGTAACATCCTTCAAGGAAGCAAAAGATGGTAAGAACTAGACGCAGGC
ACTGGTACTCTTTATTCATGGGATGCTAGCTCCACTTACATTGCCAACCCACCCTTCTTC
TCCTCAACTCAGAAGGACCCACAACCAATTAAGGACATTAAGGAGGCTAACTGCCTCTTG
AATATGGGTGATTCAATTACTACTGATCATATTTCCCCAGCAGGTAAAATCGCTAACAAC
TCACCAGCTGCTAGATTCTTGAAGGATAAGGGTGTATAACCAGTAGACTTCAATACTTAT
GGTGCTAGAAGAGGAAACTTTGAAGTTATGGCAAGAGGTACTTTTGCCAACACTAGACTC
ATCAACAAGATGATGGATAATGTTGGTCCACAAACTGTACATGTTCCCTCAGGCCAAAAG
ATGGCTGTATGGGATGCTGCAGAGAAATATATGAAAGAGGGTAAAGACACTATTATCTTG
GCTGGTCAAGAGTATGGATCAGGTTCCTCAAGAGATTGGGCTGCCAAGGGTCCTTATCTT
CAAGGTGTCAAGGCAGTTGTCGCTGAGAGCTATGAGAGAATTCATAGAAGCAACCTTGTT
GGTATGGGTATCCTCCCACTCCAATTCAAGAAAGGAGAGAATGCCGACAGTCTCGGATTG
AACGGTCATGAAACTTTCTCAATTGGCTTGAACGGTGGCAACTTGAAGGTTGGTTCAGAA
ATTGAAGTTACAACAAACACTGGCAAAAAGTTCAACGCTGTTGTCAGAATCGATACTGAC
CCAGAACTCTAATATTACAAGAACGGAGGTATCTTACATTACGTTCTTAGAAAGCTCATG
AAGTGA


>Contig1319.1.g107(protein)
MKRFFAKKVSEQGNKSQLQHTVQRSFASGPQKNPYASVLSNLSVGNQKYSLYNLPALQDK
RIERLPYSIRVLLESAVRNCDEFSVKQKDVERILDWVNTSQKDVEIPFKPARVILQDFTG
VPAVVDLAAMRDAIKRLGGDPLKINPLCPVDLVIDHSVQVDIAGTKDAREKNEALEFDRN
RERFQFLKWGSKAFNNFKIVPPGSGIVHQVNLEYLARVVFNQDGLLYPDSVVGTDSHTTM
INGLGVAGWGVGGIEAESVMLGEVISMVLPQVVGFKFTGQLQKHVTATDLVLTCTQILRK
RGVVGKFVEYYGPGVKTLTLADRATISNMAPEYGATMGYFPVDDQTLNYLRLTGRDEQQV
KTIESYLRQQNMFVKHDGSQQDPEFSGEVIELDLSSVQPSLAGPKRPHDRVNLSDMRTDF
TTSLTSKVGFKGYGLPQEHTKTVAKINYQGKDYELTHGSVVIAAITSCTNTSNPDVMLAA
GILAKNAVERGLSVKPYIKTSLSPGSEVVSAYFGEADVQKYLDQLGFTTAGYGCMTCIGN
SGEIPKEVQDAIVDKDLVAAAVLSGNRNFEGRVHPNTRANYLASPPLVVAYALAGRVDID
FEKEPLGIDKQGKEVFLRDIWPDRPVVTGVSGKVITPEMFKKIYGNILQGSKRWQELDAG
TGTLYSWDASSTYIANPPFFSSTQKDPQPIKDIKEANCLLNMGDSITTDHISPAGKIANN
SPAARFLKDKGVQPVDFNTYGARRGNFEVMARGTFANTRLINKMMDNVGPQTVHVPSGQK
MAVWDAAEKYMKEGKDTIILAGQEYGSGSSRDWAAKGPYLQGVKAVVAESYERIHRSNLV
GMGILPLQFKKGENADSLGLNGHETFSIGLNGGNLKVGSEIEVTTNTGKKFNAVVRIDTD
PELQYYKNGGILHYVLRKLMK