Identifiers and Description

Gene Model Identifier

Contig15298.0.g14

Standard Name

ABT1

Aliases

Contig15298_0_g14

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006703304.001118334825066e-42hypothetical protein
SGDYNR054C3.9990760533890984e-36ESF2 SGDID:S000005337, Chr XIV
from 724306-723356, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15298.0.g14(coding)
ATGAATAAAAAGGCATTAGATCCTCGCTTTGCTTAATAATTTTCTGAAGATGAAGACGAT
CACTCACACATTGAAGATTCTGATATGCAAGAAGATATTTAAGAAGATGAAGATAATGAT
ATTGAGTCTCAACCAGACAATGAAGAATAAGATGAAGAATAAGATTTATAATCATAAGTA
GATGATGCTAAAGAACTAGAGGCAGAACATTTACTTAATTTACAGAAGGCAAACAACAGA
GGAGTATGCTATCTCCCTCGTATTCCACCATTCATGAACCCTATGAATCTCAGGAAACTT
ATGTCAAATCGTTTTCAGATAGAAAGAATTTATCTTGGTGCTGAAGCTGAGCATGTGACT
AAGCAGAGAAGAAAGCAGGGAGGAAACCACAAAACTAAGTACACCGAGGGTTGGATAGAA
TTCACTAAGAAATCTGAAGCCAAGATGGCAGCACTGGCATTAAATGGCACCCAGATAGGA
GGCAAGAAGAGGCGTAACTTGTTCTATGATGACATTTGGACTATCAAGTACCTACCTAAG
TTCAAATGGCAGCACCTGACTGAGAAATTGGCATATGACCAGAAAGTGAGGGAGTAGAGA
CTTAAGACATAAAATGCACAAGCGAAAAAGGAGATAAACTTCTACATGGAGAAGGTAGAT
TTGAAGAAGAAACTTGATAAAATGGAGGAGAAGAAGCAGAAGAAGATGGATAAATAACAA
CACAATGCTAATGAAGCTGATGAGAGTGATGATAATGATTAGAAGGATGATGGAGTTGCT
GAATTGGGTCATGAAAAGAAGAAAAAGAAGAACTTGGTGAAGATAATGAAGTATAATCAG
AGGAAGAGGAGAGAGTTCAAGCAGAGAACACCAGTGATGTGA


>Contig15298.0.g14(protein)
MNKKALDPRFAQQFSEDEDDHSHIEDSDMQEDIQEDEDNDIESQPDNEEQDEEQDLQSQV
DDAKELEAEHLLNLQKANNRGVCYLPRIPPFMNPMNLRKLMSNRFQIERIYLGAEAEHVT
KQRRKQGGNHKTKYTEGWIEFTKKSEAKMAALALNGTQIGGKKRRNLFYDDIWTIKYLPK
FKWQHLTEKLAYDQKVREQRLKTQNAQAKKEINFYMEKVDLKKKLDKMEEKKQKKMDKQQ
HNANEADESDDNDQKDDGVAELGHEKKKKKNLVKIMKYNQRKRREFKQRTPVM