Identifiers and Description

Gene Model Identifier

Contig14340.0.g91

Standard Name

ABCF3

Aliases

Contig14340_0_g91

Description

ABC transporter

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003131199.997093137033517e-262predicted protein
SGDYFR009W1.9994249217050915e-157GCN20 SGDID:S000001905, Chr VI
from 162488-164746, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14340.0.g91(coding)
ATGGAAGACTACAGTTCGTTGCCTAAGAGCGCTACTCCCTAGACAGACGAGAAAACACTA
AAAGAAATTGAGAAAATTCTCAAGTCATAAATCAAGACTAAGTCCTTAACAGAGGAGGCT
TTCACCTATATGTCTTTGATTGTGAATGAAGACGCTCCAAAGAACGCAGCTGAGCTTATT
TCTTTGATTGGAGACTTCATGACTGATGGTATGGCCTACACTGAAGATGAGGCACTGAAG
GCTTCAGAACATATAATGAAGTCATTGCTTGACCAAAAACTTCTTAAAATTGAGAACAGA
GATACCATTACCGCCGAGAAGCTAAGCAACCCAATCGTTATTAACGAAATAAGATAGAAG
GGGTATTCTGGTGTTATCAGAGAAGAGGAATTTTCAGATCCATTCCTTGATAGTGAAAAG
ACTGGTAACTACAATACTTTTGAAGACAAACCTTGGGAGCTAAAGAAAAAGAAGAAGAAT
AAGGATGAAGACAGAGCTCAAGATGCACTTGACAAAAAGATTGAAGAATTCATGATGCAC
AAGAAAAGAGTGCCTGTCCCTACTGTCGTTCATGATAAACAAGACCCATTCAAAACTGAT
ATTATCATACCAGGTTTGATGCTTGTTGCTGGAGGAAAGACTCTTTTGGAAGGAGCTACT
CTTAAGATTGTTCAAGGTAGAAAGTATGGTCTAGTGGGTAGAAACGGTATTGGTAAAACT
ACCCTTATTAATGCCATTTCAAGAAGAGAAATCGATAAGTTCCCTTAAAACCTTCACATT
CTGTAAGTTGAGCAGGAAGTCGAAGCTGATGATATTTCAGTTCTTTAGCATGTGCTTAAT
TGTGACGTTGAGAGAAATAAGCTTCTTAATGAACTAAACGAACTCATGCAAAAAGAAAAT
CTGACTCCAGTTGAGTAAGTTGAAACCAACGTTAAAATCTAAGCTGTAAATGAAAGACTT
GTTCATATTTAAGCAGAGAAATGTGAATCAAAAGCCATGAAAATTTTATCTGGTCTCGGT
TTCGCCCAAAACGAATTTGACATCCCATCCAAAAATTTCTCAGGAGGTTGGAGAATGAGA
ATCGCTATTGCTAAGGTCGTGTTTTGCGAGCCTGAGATTTTGTTACTTGATGAGCCAACT
AATCATTTGGATCTCAACGCTCTCATTTGGCTTGAGGATTATATCAGAGCTTTGGACATC
ACTGTTATTATTGTGTCTCACGCTAGAGATTTCTTGAATGTCACCGTCGATGAAATCATT
TACTTCTTCAATCAGAAATTGACTTACTTTAAGGGTAATTTTGACAACTTTGAAAAAGTT
AAGAATGAAAAAATGAAGCTTTAACTCAAGTAAAGAGAATCCCAGCAAGACAAGATTGAG
CACATTCAAAAGTTCATTGATAAATTCAGATACAATGCAAAGAGAGCTAGTTTGGTTCAA
TCCAGAATTAAATCAATCTAAAAGATGGATGTCATTGAAGAAGTAATCTATGATCCTACT
TGTGTTTTTATCTTCCCAAATCCAGAGAAGCTATCACCACCTATGCTTAGACTTGATGAG
GCAAATATCGGATATGTTCAAGGCAAGAACATTCTAGAAAAGGTTAACATGAATCTTGAT
CTTGAGACAAGAATCTCCCTTGTTGGTCCTAATGGTGCTGGTAAATCAACCCTCTTGAAA
GCTCTTATGGGAGAACTTTAGGTTTTCGAAGGTCATTGTTTCATTCACAACAGATTGAGA
GTCGGAGTCTTTACCCAACATCATTTGGACTCACTTGATATGAGATTATCTGCAGTTGAG
TAGATGATGGTTACTTACCCTAATGTTCATAGTGAGAAGTTCAGATCTCATCTTGGAAGT
TTCGGTATTAGTGGTAACTTAGCCTTAAGACCAATGTATCTCTTATCTGGAGGACAAAAG
AGTAGAGTTGCTTTCGCCATGATCACTTGGACAAAGCCTCATATTCTATTGCTCGATGAG
CCCACAAATCATTTGGATTTCGACGCTATCAATGCTTTGATTGTTGCTTTGAACAACTTC
GAGGGAGGTATCGTTGTGGTATCTCACGATCAATATTTCTTGAGTAGCGTGTGCGATAGA
ATGTACGTCGTTAACAAAAAGAAGGTGAAGTTATTCGAAGGAGATATTAATGACTACAGA
AAGAGTCTAATGAAATGA


>Contig14340.0.g91(protein)
MEDYSSLPKSATPQTDEKTLKEIEKILKSQIKTKSLTEEAFTYMSLIVNEDAPKNAAELI
SLIGDFMTDGMAYTEDEALKASEHIMKSLLDQKLLKIENRDTITAEKLSNPIVINEIRQK
GYSGVIREEEFSDPFLDSEKTGNYNTFEDKPWELKKKKKNKDEDRAQDALDKKIEEFMMH
KKRVPVPTVVHDKQDPFKTDIIIPGLMLVAGGKTLLEGATLKIVQGRKYGLVGRNGIGKT
TLINAISRREIDKFPQNLHILQVEQEVEADDISVLQHVLNCDVERNKLLNELNELMQKEN
LTPVEQVETNVKIQAVNERLVHIQAEKCESKAMKILSGLGFAQNEFDIPSKNFSGGWRMR
IAIAKVVFCEPEILLLDEPTNHLDLNALIWLEDYIRALDITVIIVSHARDFLNVTVDEII
YFFNQKLTYFKGNFDNFEKVKNEKMKLQLKQRESQQDKIEHIQKFIDKFRYNAKRASLVQ
SRIKSIQKMDVIEEVIYDPTCVFIFPNPEKLSPPMLRLDEANIGYVQGKNILEKVNMNLD
LETRISLVGPNGAGKSTLLKALMGELQVFEGHCFIHNRLRVGVFTQHHLDSLDMRLSAVE
QMMVTYPNVHSEKFRSHLGSFGISGNLALRPMYLLSGGQKSRVAFAMITWTKPHILLLDE
PTNHLDFDAINALIVALNNFEGGIVVVSHDQYFLSSVCDRMYVVNKKKVKLFEGDINDYR
KSLMK