Identifiers and Description

Gene Model Identifier

Contig1173.0.g63

Standard Name

ABCE1

Aliases

Contig1173_0_g63

Description

ABC transporter

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008505709.997093137033517e-262ABC transporter family protein
SGDYDR091C9.997093137033517e-262RLI1 SGDID:S000002498, Chr IV
from 628534-626708, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1173.0.g63(coding)
ATGGACACAGAAGATAAGTTGAGAATCGCTATCATCAATCCTGATAAGTGCAAACCCAAG
AAGTGCAAGCAAGAATGCAAAAAAACTTGCCCCATTAATAAGACAGGAAAGATCTGCATT
GAGGTTGCCCCAACTTCCATTATATGTTTTATTTCAGAAGTATTGTGTATTGGATGTGGT
ATGTGTGTAAAGAGATGTCCATTTGAAGCCATCAAGATTATCAATTTACCCAAGGGATTG
ACCAATTAAGTTACCCATAGATATGGTCCTAACTCATTCAAGCTCCATAGATTGCCTCAA
CCTAGATCTGGTCAAGTATTGGGATTAGTGGGAACTAATGGTATTGGAAAGTCAACTGCT
TTGAGAATCTTGAGTGGAAATATAAAGCCAAATCTTGGTAGATATGAGAACCCTCCTGAA
TGGAAAGAGATCCTTAAATTCTTCAGAGGAAGTGAATTGTAAAACTATTTCACAAAGATG
CTCGAGAATAACATGAAAGCTTTAATTAAGATCCAATATGTAGACTCCGTAGCCAAGTCA
AAGGCAGCTCAAGGTATCGTTGGAAAGCGTTTGTAAGCAGTTGATAAGAGAGGACTCTTC
TAACACGCAGTAGAGATGCTTGACTTATAGAGTATTTTAGAAAGAGAAATTGGCTAACTT
TCAGGAGGAGAATTGCAAAGATTTGTTATCGCTATGACTAGTTTGTAAAGCGCAGATATA
TACATGTTCGATGAGCCAAGTTCTTATTTGGATGTCAAGCAGAGACTTAAGGCAGCTAGA
ATGATCAGATCTCTTCTCACACCAGAGAATTACGTTATTGTTGTTGAGCATGATTTGTCA
ATTCTCGATTACATGTCTGATTTTATCTGCTGTCTTTATGGTCAACCAGGTGCTTACGGA
GTTGTTACCATGCCATTCTCAGTCAGAGAAGGAATCAATATTTTCTTGAGTGGTTTCGTC
CACACTGAAAATATGAGATTCAGAGATGAGGAATTGACTTTCAAGGTATCTGAATCAGAA
GAAGAGAAAGCATAATTAGGAGGCCACGAAAAGAAAGCTCACTATAAATATCCCGCCATG
TCAAAAACAATGGGAGAGTTTTAGATTAATGTTGAAGCTGGTACATTCTCAAACTCTGAA
ATCGTTGTTATGTTGGGTCAAAATGGAACAGGTAAAACAACACTCATTAAGATGTTGGCT
GGTATCCTCAAGCCTGATTAAGAAGATGTTGAAATCCCACAGCTAAATATCAGTTTGAAG
CCACAAACCATTGCACCTAAGTTCGAAGGTACTGTCAGAGAACTTTTGTATACTAAACTT
TCAACTATATGGGAAGCTCCACTCTTCAAGACTGAAGTTACCTAGCCACTCTAACTTGAA
CCACTCCTTGATAATCTTGTAACAACATTATCTGGTGGTGAGTTACAACGTGTCGCTATC
ATTCTCGCCCTCGCTAAGCCCTGCGATATTTACTTGATCGATGAGCCTTCGGCCTATCTA
GATTCAGAGCAAAGAGTCATTTGTGCTAAGGTAATCAAGCGTTGGGTGCTAAACAGCAAG
AGAAGCGCCTTCATCGTAGAGCATGATTTCATTATGGCTACTTACCTCGCAGATAAGGTC
ATAGTATTCGATGGTGAGCCTGCCAAGAAGGCCTACTGTACCACTCCAGAAGGTATGGTC
AGTGGCATGAACAGATTCTTGAAAATTATGGATATCACTTTCAGAAGAGACCCAACTAAC
TTCAGACCAAGAATCAACAAACTTGAATCACAAAAGGATCAAGAGCAGAAGGCCGCTGGA
AACTACTTCCTTATGGAGACTTCAGAGAAGGAAGAAGTCGAAGAGACCAAAGAAGCTAAG
GGTGGAAAGGGAGAAAAATCTAAGAAACCTGCTGATGGAGTCAAAGAAGGCGGTGCCAAG
AAGAGCAAAGCACCTAAAGAATGA


>Contig1173.0.g63(protein)
MDTEDKLRIAIINPDKCKPKKCKQECKKTCPINKTGKICIEVAPTSIICFISEVLCIGCG
MCVKRCPFEAIKIINLPKGLTNQVTHRYGPNSFKLHRLPQPRSGQVLGLVGTNGIGKSTA
LRILSGNIKPNLGRYENPPEWKEILKFFRGSELQNYFTKMLENNMKALIKIQYVDSVAKS
KAAQGIVGKRLQAVDKRGLFQHAVEMLDLQSILEREIGQLSGGELQRFVIAMTSLQSADI
YMFDEPSSYLDVKQRLKAARMIRSLLTPENYVIVVEHDLSILDYMSDFICCLYGQPGAYG
VVTMPFSVREGINIFLSGFVHTENMRFRDEELTFKVSESEEEKAQLGGHEKKAHYKYPAM
SKTMGEFQINVEAGTFSNSEIVVMLGQNGTGKTTLIKMLAGILKPDQEDVEIPQLNISLK
PQTIAPKFEGTVRELLYTKLSTIWEAPLFKTEVTQPLQLEPLLDNLVTTLSGGELQRVAI
ILALAKPCDIYLIDEPSAYLDSEQRVICAKVIKRWVLNSKRSAFIVEHDFIMATYLADKV
IVFDGEPAKKAYCTTPEGMVSGMNRFLKIMDITFRRDPTNFRPRINKLESQKDQEQKAAG
NYFLMETSEKEEVEETKEAKGGKGEKSKKPADGVKEGGAKKSKAPKE