Identifiers and Description

Gene Model Identifier

Contig20209.0.g50

Standard Name

AARSD1

Aliases

Contig20209_0_g50

Description

tRNA synthetases class II (A)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01411 ) tRNA synthetases class II (A)
  • ( pfam07973 ) Threonyl and Alanyl tRNA synthetase second additional domain
  • ( pfam01661 ) Macro domain
  • ( pfam10144 ) Bacterial virulence factor haemolysin

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004731101.000499495426459e-47hypothetical protein
SGDYNL040W0.000000000029994712494008525YNL040W SGDID:S000004985, Chr
XIV from 553380-554750, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20209.0.g50(coding)
ATGGAGTCAACAAGCAGCGTTCAGGCTACTGTTTCAGTAGAGAGTGGAGTCGAAGAGATT
CAAAAGAGAGTGGAAGAACTCAAAGTTTAAGATAAATTGCAACATAAAACTCATAAGCAA
TACTTTGAGGATTCATACTTGTTTCAATCATAAGGAAAAGTTATTGCTACTTATCAATCA
GAAAAGAGCACTGATATTGGTTTGATCCTTGATAACACAATATTCCATCCTCAAGGTGGT
GGTCAACCATCTGATGAGGGTGTTATTTCATCAGCAGATGGAAGCATTAAGTTCATTGTA
AAATCTCTACAACCAAAAGATGACGCAATTATTCATTTTGGAGTCTACTAAGAAGATGGA
CAGTCCTTCGAAATTGGTCAGGAAGTCTTATTGAACATTGATGAAGAAAAGCGAAGAGCC
TACGCTCAATACCATTCAGCAGGACATTTACTCGATGTAGCCCTAAACAGAATGGGAATC
ACAAGCTTAAAGCCAGGCAAGGGCTATCACTTCACCTCTGGTGCCTACGTAGAATACGTT
GGTAATGTCGACAACGCCATCAAAGACAAGCTTCCAAAAGATCTCACAGATGAAGTGAAC
AAACTTATCCAAGAATAAAAAGAGAATCCTGAGGGAGTGTGGGTTAAGATGTGCACATAT
GATGAAGCAGGTCAAGTATTGAAGGATGGTGTACCACCTTATATTCCAATTGGCTCAGAT
TTAAGAGTGATTAAGCTCACTGAACAGGACAGTGGATGCCCATGTGGAGGCACTCATGTC
AAACACGTCACTGACATTCCCTATATTGAGGTTACCAAGGTGCTTAAGAAGGGCAAAAAC
ACAAGAGTGTCCTATACAATCAAATCTGCATAATGA


>Contig20209.0.g50(protein)
MESTSSVQATVSVESGVEEIQKRVEELKVQDKLQHKTHKQYFEDSYLFQSQGKVIATYQS
EKSTDIGLILDNTIFHPQGGGQPSDEGVISSADGSIKFIVKSLQPKDDAIIHFGVYQEDG
QSFEIGQEVLLNIDEEKRRAYAQYHSAGHLLDVALNRMGITSLKPGKGYHFTSGAYVEYV
GNVDNAIKDKLPKDLTDEVNKLIQEQKENPEGVWVKMCTYDEAGQVLKDGVPPYIPIGSD
LRVIKLTEQDSGCPCGGTHVKHVTDIPYIEVTKVLKKGKNTRVSYTIKSAQ