Identifiers and Description

Gene Model Identifier

Contig17366.0.g58

Standard Name

AARS

Aliases

Contig17366_0_g58

Description

tRNA synthetases class II (A)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01411 ) tRNA synthetases class II (A)
  • ( pfam07973 ) Threonyl and Alanyl tRNA synthetase second additional domain
  • ( pfam06996 ) Protein of unknown function (DUF1305)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002211409.997093137033517e-262alanyl-tRNA synthetase family
protein
SGDYOR335C4.001033848388204e-30ALA1 SGDID:S000005862, Chr XV
from 949109-946233, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17366.0.g58(coding)
ATGTAAGCTGAAGAAGAAAAAGTTGTTCAATGCAAGACAACAAAGGAAATCAAAGCTATG
GCAAGACCAGAGTTTTAATAATATCCAGAGAAATTCTACCCTGTGGAAACATTCAAGAAG
CTAGGTTTCAGCAGAAATCAATGCCCCAAGTGCTAGAACTACTATTGGAGACATAGTGAG
AAGAGAGTGACTTGCGGTGACTCAAATTGTGAAGGAACCTATTCATTTATCGGAAACGGA
GTTGGAAAAGGCAATAGAATCACTTATGCTGAAGCATGGAAAGGATTTGAGAAATCATTT
ACTACATCAAGAATCCCCTGCACCTCAATCAAGAGATATCCAGTAGTCGCTCGTTGGAGA
AATGATGTAGACTACGTCGCTGCAGGAATTTTCTGTTTCCAGCCATACTGCGTCACTGGT
GAGTTAGACCCTCCTGCTAACCCCTTGATTTGCCCACAGTTCTGTGTCAGATTTAATGAT
CTTGATAACATTGGTATCACTGGTCGTCATTACAGTGGCTTTATCATGCTTGGTATCCAA
GTGTTCAACTATCCCGAGAAGTATACCTTTTTCAAGGACGAGTGCGTTGAGTTCAACTAC
AGATGGTTGACTGAAGAGTTAGGAATTGAACCTGACGAAATTACCTTCATTGAAGATGTT
TGGGCCGGTGGCGGTAACCTTGGTCCCTCAATTGAGTATTTCGTGAGAGGTCTTGAGGTC
GGTAACATGGTTTTCATGCAATACAAGACTTTCCACGATGGATCAAGAGAAGAACTTTAA
ATCAAGGTGATCGATGTAGGTATTGGTCTTGAAAGAATCGCATGGTTGTATAATGGTTCA
GCCACCTCATATGTAGACACTTTCCATCACGCACTTACTTACCTCAAGACTAAGGTTAAT
GTTGAGATCAACACTGAAATCTGGGACAAGTTCGGTCCATACTCTTGTTTACTTAACATT
GATGAGATCGAAGATGCTGATAAAACCTATGCTGAAATTTCTGAAAAGATTGGAGTTGAC
GTTGAATCATTGAAAAAGGCTATTACCCCAGTCAAGGACATGTACATTATTCTTGATCAC
ACTAGAAGTATTTTGATGACAGTGACAGACGGTTCCCTCCCTGCCAACGTTGGTGGTGGC
GGTAATGTAAGAAACATTTTACGCAGAGTGTTCTCAATCATGGAAAAGAACGATTGGTGG
ACTCAGATGCCTATGGAGGACTTCCTCAAGATCTTCGAGATGCACAAACTTGACTTTGGT
GGAATTTACGGTAAATTCGACGAGTATAAATCATTCGATGACATCATCAAGGTTGAATAT
GACAGATGGAAGAACACCGACGAAATCTAAAGAAAGAACCTCGAGAAGGTACTTAAGACC
AAGAAGGGCAAGCTCGATATTGATGACTGGATTGTTGCCATGTAATCATGGGGTATTCCA
GCTGATAGCATCGCCCAAATTTCAGGTCTAAGTGTTCCTAACGATCTCTATTATGAAATC
GCTCAACGTTAAGAGAGAATCGCAAAAGCACCAGAAGTTATTCTATATTCAACTGCCCAT
CTCCCAGAGACTGAGAACCTTTATTATCAAGATCACAACTTATTTGATTTTGATGCTGAA
GTTGTTGATATCTTCTCTAATGTATTGGAAGGAAACAAGAGAAACATTCTGATCATAAGT
CAAAGTGCAGTGTACCCTACTTCAGGAGGACAGCAACACGATAAAGGAACCATTCATATT
GAAGGTATCCCAGAGCCATTTGAAATCAAGAATGCAGAGAAAGTTGGTAAAGTTGTATTG
CACATTCTTGACAGAGAGATCCCATTAGAGATCGAACAATTAAAGGGAAAGAAAGTACAT
GTTGAGATCGATAGAGAGAGAAGAAACCAGTTGAGAGCTCATCACACAGGTACTCACATC
GTGTTTGCTGCTTGCAGAAAGGTTCTTGGACCCCATGTTTGGCAAAATGGTGCTAAAAAG
ACTGTAGACCAAGCTCACTTGGACATCACTCATTACAAGTCGTTAAGCAAGGATGAAGAG
AAAGCTATTGAAAACGAAGCCAACAGAATCATCAACAATTGCGCCAGCATTAATAAGTAC
TTCATGGATAAGGCTGAAGCTGAAAAGAAATTCGGTTTCCATCTCTATCAAGGAGGTATT
GTCCCAGGTAACACCCTAAGAGTAGTAAACATTGAAGGAGTTGATACTGAAGCCTGTTGC
GGTACTCATTGCGACAACACTGCTGAAGTTGGTTGGATAAGATTACTCAAAACTCAAAGA
ATTTCAGATGGTATTGTTAGACTTTACTATGTTGCTCAAGAGAGAGCCATTCAAGTTCTT
AACGATGAACATCAAATCTTAATTGACTTATGCGCAACTTGGGGAATTGATCAACAACAA
ATCCTTCCTACTGCTACTCGTTTCTTCAACGACTATAAGAAGCTTTCATCCCAAACCAAG
AGACAAGACCAGTAAATCTTGAACTTGCAAATCAAGTACTTGTTGAAGGACGAGCACAAG
CTCTACGTCATTAAGTCAGAGTACCCTGATCCAACTATTTATTTCTCCTTCCTCCCTCAA
TTTGCTGAGCAAATCCAAAAGACCGGCAAGGGTGTTGTCTATATCGGACCTAACTTCGTT
TTGGGACTCCTAGGTGATCCTTAACTCATGAAAGTTGCTGAAGTTGAAGCTCTATGTAAG
GAAATGAGTACAAAAGAAGTTAAATCAAGAACTCAAGATCAAGTTAAGTTCGACTTCAAG
GAGAAGGGAAAGAAACCAGTTGTCACCAAGGGCATCCTCTAATTCTCTATCACTGGATCT
GACTTTAATCTAGAGAAACTTATTGAAACCTTAAAAACTTCAGGAGCTCATGAACTAGAA
TGA


>Contig17366.0.g58(protein)
MQAEEEKVVQCKTTKEIKAMARPEFQQYPEKFYPVETFKKLGFSRNQCPKCQNYYWRHSE
KRVTCGDSNCEGTYSFIGNGVGKGNRITYAEAWKGFEKSFTTSRIPCTSIKRYPVVARWR
NDVDYVAAGIFCFQPYCVTGELDPPANPLICPQFCVRFNDLDNIGITGRHYSGFIMLGIQ
VFNYPEKYTFFKDECVEFNYRWLTEELGIEPDEITFIEDVWAGGGNLGPSIEYFVRGLEV
GNMVFMQYKTFHDGSREELQIKVIDVGIGLERIAWLYNGSATSYVDTFHHALTYLKTKVN
VEINTEIWDKFGPYSCLLNIDEIEDADKTYAEISEKIGVDVESLKKAITPVKDMYIILDH
TRSILMTVTDGSLPANVGGGGNVRNILRRVFSIMEKNDWWTQMPMEDFLKIFEMHKLDFG
GIYGKFDEYKSFDDIIKVEYDRWKNTDEIQRKNLEKVLKTKKGKLDIDDWIVAMQSWGIP
ADSIAQISGLSVPNDLYYEIAQRQERIAKAPEVILYSTAHLPETENLYYQDHNLFDFDAE
VVDIFSNVLEGNKRNILIISQSAVYPTSGGQQHDKGTIHIEGIPEPFEIKNAEKVGKVVL
HILDREIPLEIEQLKGKKVHVEIDRERRNQLRAHHTGTHIVFAACRKVLGPHVWQNGAKK
TVDQAHLDITHYKSLSKDEEKAIENEANRIINNCASINKYFMDKAEAEKKFGFHLYQGGI
VPGNTLRVVNIEGVDTEACCGTHCDNTAEVGWIRLLKTQRISDGIVRLYYVAQERAIQVL
NDEHQILIDLCATWGIDQQQILPTATRFFNDYKKLSSQTKRQDQQILNLQIKYLLKDEHK
LYVIKSEYPDPTIYFSFLPQFAEQIQKTGKGVVYIGPNFVLGLLGDPQLMKVAEVEALCK
EMSTKEVKSRTQDQVKFDFKEKGKKPVVTKGILQFSITGSDFNLEKLIETLKTSGAHELE