Identifiers and Description

Gene Model Identifier

Contig16930.0.g78

Standard Name

AAR2

Aliases

Contig16930_0_g78

Description

AAR2 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water (IEA) | GO:0016717

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003886004.0006511639687014e-23conserved hypothetical protein
SGDYBL074C0.000019995566179747357AAR2 SGDID:S000000170, Chr II
from 87789-86722, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16930.0.g78(coding)
ATGCAATTTGGTATAGACAATTAATATTGGCAGACTGGTCCAAATTTTAAGGGTATCAAG
TTAATTCCACCTGGTGCTCACTATGTTTACTACGCGCTTTAAGATGAGGAATTTGCTGCA
AGAATGGGATTTTTCATTTTCATTAATGAAGCTCAAGAGATTAGAGATAGTTAATAGGAG
GAGAGTATAGATTCAGAAATATATTACACCAAGCAGGATGTGATAGTGAGGAAATGGAAC
TCTGAGAGGCAAGAATTTGAGAAAGTTTAGGACTAACAAGAAGAAATTTCCTATCAGGAA
GGTGTCAGAAATATGGATTTTGATAAGTACCTTGGAGTTTACCCCATGCAAAATTTCTAA
CAATGGCAAGGTCTTTCTTCTTTCATAAGCAAAGAAGTTATTGATAGAATTGAATCAGTA
AACTCAAATCATACTATACTTAGTGAGGAAAATGAGCGCAAAAATCGCATATAAGAGGAT
CAACAAAAATCTTCACCTCAGATCCCTCAAGATAAATAAGAAAATCAACAATAAAAAGTT
GAAGAAATGGACCCCGACTAAGACCTAGAAAATACAATATAGGCAATACAGAAAGAGCTT
GAATAAGAAGAGAAAAGGCAATAGAAAGCTAGAGAAAAAGAGTATAAATATAAGGAAGCT
TATGGGAATTTGTATTATACACATATTCCATAGAGGAAAATTGTGCAAGGGCTGACTGGC
AGTGCACTTACTGAAGCTAACTTTGATAAAAGTATGATACTTAATGATCTTCTGTATAAG
GAATACAACTAAAACTCCAATTTGCTTCTTGGTGAACTGCAATTCGCTTTTGTCACTTTC
CTATTAGGTGAGAACCTAGATTCCTACGAATAGTGGAAACGCATGATTTCCATGCTGACC
ACTTGCGATTAAGCTCTAACCCAATCAGACCAGATGACTCAGGATCTATTCTACAAATTT
ATCCCCATTGTTTATGAGTAAACACGCCAGCTGCCTAAGGATTTCTTCCAAGCTGAACTC
TCAAAGCAAAACTTCATTAATGACTGCATGCGCTAATTCATAAAAATTTGTGAGGAATAA
CCTGCTGTGGTTGTATAAGAAGAAGATTAATAAATCTAAACGACAAATGTGGTATCAACA
TTATACGATTAAACTAGTGGAGGAGTGAGTAAGAGAATCAAGTAAAGAGTAGCAAAATTG
AAGTAAATGTTGGTGGAGGAGTATGGATTCAAGCCATTTATGAGTTTGGAGGACAGATTA
ATGCAGTAAATGAAGCTAAATGAGGAGAAAGATATTAGGTCGAACAGAACTAATAACAAT
TAGGATGAAAATTAAATGTAAATTGACAGCTTAAATGGCAGTATATAAACGAAAAATCAC
GTTAAAGTAGATGCCAAATAGATGAGAGATATGCTGATATAAGGAATGAAAATGAAGAAA
GATAATGATGGAGATGATGATGATGAGGAATTTGATGAGGATGAACTGCCAGTGATTCTT
GATGAACATGAATAGTTTATTGATCTCTCGTGA


>Contig16930.0.g78(protein)
MQFGIDNQYWQTGPNFKGIKLIPPGAHYVYYALQDEEFAARMGFFIFINEAQEIRDSQQE
ESIDSEIYYTKQDVIVRKWNSERQEFEKVQDQQEEISYQEGVRNMDFDKYLGVYPMQNFQ
QWQGLSSFISKEVIDRIESVNSNHTILSEENERKNRIQEDQQKSSPQIPQDKQENQQQKV
EEMDPDQDLENTIQAIQKELEQEEKRQQKAREKEYKYKEAYGNLYYTHIPQRKIVQGLTG
SALTEANFDKSMILNDLLYKEYNQNSNLLLGELQFAFVTFLLGENLDSYEQWKRMISMLT
TCDQALTQSDQMTQDLFYKFIPIVYEQTRQLPKDFFQAELSKQNFINDCMRQFIKICEEQ
PAVVVQEEDQQIQTTNVVSTLYDQTSGGVSKRIKQRVAKLKQMLVEEYGFKPFMSLEDRL
MQQMKLNEEKDIRSNRTNNNQDENQMQIDSLNGSIQTKNHVKVDAKQMRDMLIQGMKMKK
DNDGDDDDEEFDEDELPVILDEHEQFIDLS