Identifiers and Description

Gene Model Identifier

Contig16719.0.g105

Standard Name

AAA2b

Aliases

Contig16719_0_g105

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005718002.000341663036036e-86hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16719.0.g105(coding)
ATGAAACACAAAACTGATAGATTAGCAACTAAGAATCTATATGACCATTAAGACCGAGCT
CAAGAACTTAAAAAGCTACTAAACAATCAATTTAGAAATGTGAAATCTGCCTCAGAAGTG
CATGTTTTGTTAAATGAAGCCAAATTCATCGATAACGTCGACACCCTGGCATAATTATCT
CAATCTATGAATGAATTTATCAAAGGAAAAGGATCTTTAACTCCAAATGGAGTAATTATA
AAAGATTAGATAGGACTAGAAGGGGCTTAGAATAAAGGAGTTAACATGCTTGATCTCAAA
CTTAACACAAGAGGCATCGGGGAGGATGAAACATATGCTCTTGATGGATTTCTAGTTAAA
AACATCAGAAGAGGAAATACAATCATTGAGATTGTTGAAAAAGAAATGAAGAAATATGAA
GATGGAGATGAAGTACCCTGTGCTGGAAAAGTTCTACGAAGATACATGGGCAGAAAAGGG
TTGACAAAGTTCTTTGACTTAGCAATTGAATATGTAGATCCAAGAACTCGTTATGAAGAC
AATCATCTATCCTCCACAAGTTTTTGCATTAAAAATCAAATCCTTGCTGAAGCTTTCCAA
ACTTTGCTTGCAGGAGATCACGTTGAAATCCTGAAAACCCTAAAAGCTAATGGTGAGAAC
GCACAGATTTCCTACAACCCAGATGTTGACTGCTGGGTTTCAGCCTCTAAGAATGTTGGA
ATTTTGTTGAGAGACAGAGAAGACATTAAGAAATATGATAATCAGCATTTTAACTTTGCT
AAAAAAATTGCTGATGTCTGGTTTAATAAGCTTGATGATCTTAGAGAGAAAGATCCATAA
TTAATAGATCAATTGAAGAAAGATATGGCAAATAAAACTTTAGTAGCTGAGTACATAGGT
AACATTGAACATTAACACATGGTGAAGTACAACTAGACTACTCTAATCTTCTATGCTGTG
GTTGAAAACTACTCTCCTGATATATGCTGGCCAACAGACCAAGCTTTGGATTTTTTCAAG
CGTTATGACTTGAATGTAGTGAGAATCGAGAGTCATGGTTTGTATAATAGCTATGAGATG
CTTTGCAATGGCTTGTATAAAGTTTTCAGAGATGTAGCCAAGGGCAAGATCGTTGATGAA
GAAGAGGGCAGTGTCCTCTACTTGGTAAAAAGAGACAAAGATGGTGACAAATCTAAAGAT
AAGGTTCTAAGTCTAGCCAAGTTGAAGACTATTGAGTATAGAATCTTTAGAAAAATCAGA
GAAAAGTTACGTGGATTCTACAGACACGAGTCCAAAGTAGACGAAAAGGGAAGAGCAAGA
AAGTCCCATGATCATATCATTAATGCTTTCCAAAGAGAAATGAGTTCCATTACTGAAGGT
AATGAGTTGCCGTAACCCATTGAGTTCTATGTCACTTTATTGAAAGCTTCATTTGATTAT
GTAAATGATGATCCTGAACCAAGAATATCCGCTTTAAACAATGAGTACATCAACTTCCAA
GAAGGATTGTTAGAGTATCATAAAAAGAAAATGTAATTGAACGTTCTTGATACCAATTTA
TTCGAGTCATCTGTGCTAGATAAGTAATAAGAAATTGTTTATTAAAGACCTTAAGAAATT
ACTCAGATAGAAACTCCTATTACTCATGATGAAGAGTCCAAAAACTCAAACAACTTTAAA
TAAAAGCTATACCAATCCATTTTTATTCTTCTAACTCCACCAGGCATCTTAACCTAAGAC
AATCTTGACCTTTTATAAATTTCTTACAATATCATTGAGTTAAATTCAAACCATGATGAC
CTACAAAGTTAATATGAACAATTATCTTAAAAGTTGTTCACACCCACTTTAAAACCTAAT
TTGATAGTTTTGCACCACATCACTCCATTTTTAGTGTAATTATTGGATCAGTTAGAGCAA
TCTATACATCAAAACGATGTCAAGTTATTGAGTTACGGGTTTAATATCAATGCCAAGGAT
CAATTTATAGATTACCAGTTCAAAAATAAAGAAGAAGGTCTTCCCACTTCAAAAGCAGCT
TTAAACAGATACTTTGAAGATCAGCTCGTTGTATATTAATAGAAAATAAGTACAATTAGT
AGTGTCATTCAAGTTAAAAATGCATTCTAAGAATTACAAAACGCTTTAAGTATTGCCAAA
AGTCAAAGCAAATTTACATTAGTAGAAGGATAAGAAGAATCAAAGGAGGTAAGAGAAAGA
GAACAGGAAGAACTCAAATCATATGAAATTCAGCAATAATAGAGAAAAGCTAGCGAGGAA
GTTGATATTGATATTTTATATCCAACTCTGGAATCGAAAATACATGAACTTAAGACAATG
AACAGAACCAAGAAAATAGTGATAGTTGTGATACCATTTGGCACCACAGGCAGTGGAAAA
TCTACTTTCAAAAACTACCTTGAAAAATATGTGGTGGATTAATTTGGATGGCGTTTTGAG
TCAGTCTCAAGCGACGAGTGCAGAGGAAAGGTTATGTAGAATCTAATGGCTAATAAAAAG
TTAAGTAGGGAGTAAGCTTTTGACTAGTCTAATAAGAACGCTTTGTCTATGTATAACGAT
CAATTGGGTAGAATATTAAGAAAAATTGATAAATCTCCAAGTAAAATTAACATAGTGTAC
CTTGATAAAAATCATCCTATAAACGGTCTACCTAGGGCAGTCGAGGTTGTTGAATAAAAC
ACCCCTAAAAATGTGATTTTAAAGAAAGTTTATCTTATACCAAAAATTTCTGACCCAATC
AGAAGATACCCATTCAGCTACAACTTCTTGATTCAGTGTTTCTTGAGATTGATGTCAAGA
GATGACCATGAAACACTTGACAATTCAAATCCCATTGAAACAGCTTAGATTCTTTTGATG
TTTTTCCATTTGTACTTACATGTCAAGTTCGATTCACACCTCCTTTAACAATACAGATTG
GACAACTATTTCAAGATCCCTCTTACTGCTGATTGCAAATCCTTAAACGAGGTACCACTC
TCTATTCAATCCAAAGTGGATTAATTATTCAAAAACACAAAGAAAGGGGACAAACCTTAA
GATTTAGCGCTTATTCAGCAATTTATAGATGAATCTTTAAAACTGAAAGATTACTACTCT
GAGCATGCCAAAATAGACTAAACAGACTTAGATAACTCCATTCTCACTGCCTTGATTAGA
ACTCTTGAACCATACAAATCAGATGAAGTATTGAAGGAAGAAGAAAAAGTATAGTAATCC
TAGGATTAAGATCAAAATAAGAAGGATTATCAAGATCAGTAACATTTGAAGAAAGAGAAA
CTTCCATTGTATTTAGGAGTGAGTGTAGAGGATGACCCAGAACTCAACAAGAAACTGGAG
AAAGTATTGTCATAAACTATAGAATAGCTCAAGCAAATAGATAGTGAAGAAGAAGAGCAA
AAAGACTATGAAAAGATGCTCTCATAATGCATAGATTCTATGAGAAATGATGATAAAAAG
TCTTAAAAAGACACATGGACAAAAGCTAAAAGTTTCCACGTGACGACTGCTTTCTTAGGT
AAATTCAGCATGCCAATCAGATATCAATTTCTTAAGAAGTTTGAAGAAAATCAAGATGTC
CCCGTTGAGATAAGAGCAGTCGTTTATTGCAAAGGGAAAATAGTGACTAGTTTATGCAGA
CCTTAAATAGAAGTGTAAAATAGAATACCACACATGACCACAATGCTCTTCAATGTAGCC
GCAAAATTCTCAAACGACATACTTGAAAGTACCTGCATAAAAGGCTAGCTATTTAGTGAA
ATATACGAGGAAACCTTTAAAAACTAAGAAATAGGGTAAGGTTTGATTGAAAACGTAGAT
GAACACGCTATTTTATTCAAGAAAGGGCAAGTTAAAGTACATGATAACAAAGAGACATGC
TATTTTATAAGGTTGAAGGAGCCAGTGGTGTTCTAGGGCAAGACTAAGAAGTTTTATAAT
TGA


>Contig16719.0.g105(protein)
MKHKTDRLATKNLYDHQDRAQELKKLLNNQFRNVKSASEVHVLLNEAKFIDNVDTLAQLS
QSMNEFIKGKGSLTPNGVIIKDQIGLEGAQNKGVNMLDLKLNTRGIGEDETYALDGFLVK
NIRRGNTIIEIVEKEMKKYEDGDEVPCAGKVLRRYMGRKGLTKFFDLAIEYVDPRTRYED
NHLSSTSFCIKNQILAEAFQTLLAGDHVEILKTLKANGENAQISYNPDVDCWVSASKNVG
ILLRDREDIKKYDNQHFNFAKKIADVWFNKLDDLREKDPQLIDQLKKDMANKTLVAEYIG
NIEHQHMVKYNQTTLIFYAVVENYSPDICWPTDQALDFFKRYDLNVVRIESHGLYNSYEM
LCNGLYKVFRDVAKGKIVDEEEGSVLYLVKRDKDGDKSKDKVLSLAKLKTIEYRIFRKIR
EKLRGFYRHESKVDEKGRARKSHDHIINAFQREMSSITEGNELPQPIEFYVTLLKASFDY
VNDDPEPRISALNNEYINFQEGLLEYHKKKMQLNVLDTNLFESSVLDKQQEIVYQRPQEI
TQIETPITHDEESKNSNNFKQKLYQSIFILLTPPGILTQDNLDLLQISYNIIELNSNHDD
LQSQYEQLSQKLFTPTLKPNLIVLHHITPFLVQLLDQLEQSIHQNDVKLLSYGFNINAKD
QFIDYQFKNKEEGLPTSKAALNRYFEDQLVVYQQKISTISSVIQVKNAFQELQNALSIAK
SQSKFTLVEGQEESKEVREREQEELKSYEIQQQQRKASEEVDIDILYPTLESKIHELKTM
NRTKKIVIVVIPFGTTGSGKSTFKNYLEKYVVDQFGWRFESVSSDECRGKVMQNLMANKK
LSREQAFDQSNKNALSMYNDQLGRILRKIDKSPSKINIVYLDKNHPINGLPRAVEVVEQN
TPKNVILKKVYLIPKISDPIRRYPFSYNFLIQCFLRLMSRDDHETLDNSNPIETAQILLM
FFHLYLHVKFDSHLLQQYRLDNYFKIPLTADCKSLNEVPLSIQSKVDQLFKNTKKGDKPQ
DLALIQQFIDESLKLKDYYSEHAKIDQTDLDNSILTALIRTLEPYKSDEVLKEEEKVQQS
QDQDQNKKDYQDQQHLKKEKLPLYLGVSVEDDPELNKKLEKVLSQTIEQLKQIDSEEEEQ
KDYEKMLSQCIDSMRNDDKKSQKDTWTKAKSFHVTTAFLGKFSMPIRYQFLKKFEENQDV
PVEIRAVVYCKGKIVTSLCRPQIEVQNRIPHMTTMLFNVAAKFSNDILESTCIKGQLFSE
IYEETFKNQEIGQGLIENVDEHAILFKKGQVKVHDNKETCYFIRLKEPVVFQGKTKKFYN