Identifiers and Description

Gene Model Identifier

Contig15796.0.1.g56

Standard Name

AAA2a

Aliases

Contig15796_0_1_g56

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000463601.9994274381022833e-63hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15796.0.1.g56(coding)
ATGTAGAGATAACAAAATCATTACGTAGCAAAAGGCAGTCAGCAATAGTCGAGCCAACCC
TTATATAAACCCAGATCTAAGACCCCAACTACTCAAAGAGGTCTATCCCAAGATCGTTTC
GTTGTCAAGAACTCAAATAAACAAAGCAAACCTGCTCTTGGAAACTATTATGTGAAGAAT
GTGAGTTAAACTCAAAGATAACCTTAGCCATAGAAGAAAGATAAGATCTCAATGTACTCA
TTAAGTGGTGACCCATCTCAAATCGATATCTTAACTGAAAAAGAGAAATTCCTGAAGACC
CCTGACTAAATTCATGGCTTAGTTGAAGAGTTCAAGATAATAAAAGTGCACGCTGATGAA
TGCAAGATTGATCCCAGCATTATTGTCAAAGATTTGGCTTTAACAATCAGTGGGCCAAAA
GAAGATGAGTCTTTCTCAGAGGATCCTTATCTATGGGTCAATTTCAGAAGAGGAAACACA
ATTCTGGATATCTATGATCCCAACAACTATGAATAGCTGGTCAACAGAGTGATTGGAAGA
AAAGGTCTTAGCAAATTCTTTGATATTAAGTATGACTTCGTATCAAAAGATGGAAGATAT
AGAGATCTAGATTTGAATTACTTTGAAGAAGATGTGAAGAATCATATTTTAGCTGGAGCA
AAGAAAGCGATTTTGTAGGGACATTAAGTTGAGGTTGTTAAATCTCTTAAAGCTAATGGA
GAGAACTGTCAGATATCGTGGAACCCTGAAGCAGATGCATGGGTTATCGCTTCCAAAAAT
GTGGCCTTACTCGCTAGAGATGCAGAAGATTTGTTGAAATACCCACCAAAAAGCATTAGA
TACAGTTTTGCAACTATGATGGCGAATTGCTGGTTTGAACTGATTTCAAGATTGACATCA
AAAGAGTATCAAATGTTGAAGAGTGATATGTCTAATCGCACTTGGGTTGGAGAGTATATT
GGCAACCCCAAATGCCAGCACTTAGTTAGATACCCAAGAGAAACCATTATCTTCTACGCT
ATTGTTGACAACAACTCTAGAAAGATATGTAGACTACCAGAGGATTCTTTGAAATTCTTT
AAGAAATATAACTTTGATGCTGTGCAGTTAAATTCACTTGGAGTATTCAATAATTATGAC
AAATTGTGTGATGTATTGTCTTATGAATACGAAAATGTAGCTTCTTAATCAATTCAAAAT
GAAGAAGAGGGTGCTGTCTTATACTTTGTAAAGAGAGATTCCTAGGATAAGTCTAATGAT
GAGATTCTTTCATTATCCAAATTGAAGACCTTAGAGTACCGCCTTTTTAGAAAAATGAGA
GAAAAGTTGAGAAACTATGTTAGTTAAAAGTCTATGGCAACCCCTGAAATGATTAAGGAA
AGATTTATCAAAGAATCTAGAGATTTAAGCAGAGGTTTGGGACTACCTCATCCTTTGGAT
TTCTACATTGATCTTTTCCTTCAAGCATTTGTGTTAATCTCAAGAGGTTCAATCAAAGAA
ATTCAATATTACGAAGATATGTTAATGAATGAGTATGTGACTTTCTTGGAAGAAGTTAAC
AACATCTATGAAGAGAAATACAGATCTAACAAATAGAGGTATGTTGGTAAAGTAAATTTT
AAAAGCATCATCTTAGACCATCAAGATAAAATCTAGTACAATGGATATTAGGGAGAAAGA
AATAGAAAGAATTCAGTGGAATCTTAAGAGACAGAAGTCAAAATCTAAGAGCCAAAATCT
TAAGTTTCTACTAAGGCAGATATCTAAGAGAAAAGTGAACTTAGATAAGTTTCAAATGTA
CAGCCTAAGTTGAGTTCAGCTTTGAAGACCAGTGGCTCTAGTAAAAATTCACAAGCTAAG
CCATAACATATTAAAATAAATGAGATTCCTTAAGTCAATCTTATCAACAATGATACTCAA
AACTCAGGCCCTGCAACTACTGTAGTTTATAAAAAGAAAGAACAGTAAATTAAGCAATTT
AATCCCTCAACTTCTCCAACATAGTCAAGATAGGTTCTTGAAGTTAACTACAAGCCTTCT
ATTGCCAGTTTAATTGAGAAGAAACCCTCACCAAATCCACTTTATACAAATAGAGCTAGA
ACTGGTAAAAAACAAATTGCAATCCTTTTGCCTATTGGAATTCCAGGTATGGGAAAGACC
ACTCTTATTCAAAGCATTTTAAAACCATTTTTCGAGATCACTACTGAATGTAAATTCCAT
ACTTTGTCAAATGATGAGATTAAGAGAGAGCAAATGGACTTATACATGAAGAAAAACCCT
ACTAAAACATCAAAAGATGCATTTGATAACACTCATAAGCAAACTGTTAAGATTTTCAAT
GAGACTTTACAAGCAAAAATTAAGCAAGCTGTCTAAGATGATTCTAACGATATTCATATT
ATCTGCATTGATAAGAATCATGTACCTCCCATTATATAACAGACTCTCACTATTATTGAT
CAGTCAGTGGAAGAGAAATATCGTCAAAAAGTTGAGATTTTAAAGATTGCTTTAGTTCCA
GAATAACCTAATCCTCATAGAGGTTATCCATTTTCATTAAGCATGCTTGTTCAATGTTTC
CAAAGATGCTTAGAAAGAGCCAATCATTAAACATTGACTAACGAAGATCCTAATCACTTA
GCTAGAGTGCTTTTCTTATTCTTTAGAAAATATAAGGGACAGAAGTTTGATGACTAATTC
TTGAAAGATCATGCTTTAGATGATTTTATGAGAGTCCCCTTAACATTTGAGCACGAAGAT
TTACAGTTACCAGATAATCTTCACAGAAATGTAGAGCAATGCTTAGAAAACACTGGTGAT
GCATATCCTATGCCTCATCCTGTTTTTGATAAATTTGTGCATCTAAGTCAAATCTACAAG
TCTTTCTTTAAGGGCTCTTCAGGATAAGAAGAGTACATGGATTAGCATCTTGAAAGCAAC
TTCTAAAGACTTTTCAAGAAAATTTTGAGTCCTGGCTTAAAGAAGAAGCAATCTGGTTCT
TCAAAGCAACCTCCTGAAAGAAAAATTTCACATTAAATGTTCATCGATGAACAGCTAAAT
GATTTTATCCAAAATGAGAAGAAAAATTTGAATTCTTCAAATGGTCAAACTCCTTTGAGA
TAGAACGAAATTTAGAGTGCCTCAACTACTACACCTTAACAATCAAGTCATAGAGTTGTA
GAAGAAATCAAATATGAAGAAGTTTCACATCAGGTTTTCAAGCAAGCAGAGACAAAATAC
CCAAAGAAGAAATCAAACGGATCAAAACCCATTTTGTAAAACAATTCAAATTAATAGACT
ACTGAGGTATTGAAAGGCAATTACAAGCCAAAACAAATTTAAGAGAACAACAAAATGAGT
CAATCTAATGATGATGGTTTCCAGAACACTGTTGCTAATAAAAAATAGAACAGAAGAGCA
AGCTATAGTAGTGAGGATGATGTCATAGAAAAGCTCCCAATCTATCTTGGAATTTTCTTT
GATGAAGATAATAATGCAGCAGGAAAAATCAAAAAGATACTCCTTGAATCAGTAGAACAG
CTCTTTAACTTTGATAAGATCAATCAAATCAAAACTTTGTGGGAAAGTATCAACTAATTA
TACGATACTAAGGGTGGAAAGTATAATGGTTGGTAGTTGGTAAAAGATCCTCATGTGACA
GTTCTCTATGTTGGAAGAGATTAAGAAAGAACGGAGAGCAAGATCTATCAGGAATTTGAA
GAAGATTTATAAGAATCGATCACTGTTTATGGTGTTGTAGTGGTTCCAGGAAAGATCATT
ACAGCCATTTGCTTCCCTTAACATAGTGTTGATAACAGATGCCCACACATCACCCTCTGC
ACTGGAGAATGGCAAGCCAAGATGTCAAACGATGTACTATAAGAGTCTTGTTCAAATCCT
CGTGGTAAGTCAAGGAAGGAATGGAAATCCTGA


>Contig15796.0.1.g56(protein)
MQRQQNHYVAKGSQQQSSQPLYKPRSKTPTTQRGLSQDRFVVKNSNKQSKPALGNYYVKN
VSQTQRQPQPQKKDKISMYSLSGDPSQIDILTEKEKFLKTPDQIHGLVEEFKIIKVHADE
CKIDPSIIVKDLALTISGPKEDESFSEDPYLWVNFRRGNTILDIYDPNNYEQLVNRVIGR
KGLSKFFDIKYDFVSKDGRYRDLDLNYFEEDVKNHILAGAKKAILQGHQVEVVKSLKANG
ENCQISWNPEADAWVIASKNVALLARDAEDLLKYPPKSIRYSFATMMANCWFELISRLTS
KEYQMLKSDMSNRTWVGEYIGNPKCQHLVRYPRETIIFYAIVDNNSRKICRLPEDSLKFF
KKYNFDAVQLNSLGVFNNYDKLCDVLSYEYENVASQSIQNEEEGAVLYFVKRDSQDKSND
EILSLSKLKTLEYRLFRKMREKLRNYVSQKSMATPEMIKERFIKESRDLSRGLGLPHPLD
FYIDLFLQAFVLISRGSIKEIQYYEDMLMNEYVTFLEEVNNIYEEKYRSNKQRYVGKVNF
KSIILDHQDKIQYNGYQGERNRKNSVESQETEVKIQEPKSQVSTKADIQEKSELRQVSNV
QPKLSSALKTSGSSKNSQAKPQHIKINEIPQVNLINNDTQNSGPATTVVYKKKEQQIKQF
NPSTSPTQSRQVLEVNYKPSIASLIEKKPSPNPLYTNRARTGKKQIAILLPIGIPGMGKT
TLIQSILKPFFEITTECKFHTLSNDEIKREQMDLYMKKNPTKTSKDAFDNTHKQTVKIFN
ETLQAKIKQAVQDDSNDIHIICIDKNHVPPIIQQTLTIIDQSVEEKYRQKVEILKIALVP
EQPNPHRGYPFSLSMLVQCFQRCLERANHQTLTNEDPNHLARVLFLFFRKYKGQKFDDQF
LKDHALDDFMRVPLTFEHEDLQLPDNLHRNVEQCLENTGDAYPMPHPVFDKFVHLSQIYK
SFFKGSSGQEEYMDQHLESNFQRLFKKILSPGLKKKQSGSSKQPPERKISHQMFIDEQLN
DFIQNEKKNLNSSNGQTPLRQNEIQSASTTTPQQSSHRVVEEIKYEEVSHQVFKQAETKY
PKKKSNGSKPILQNNSNQQTTEVLKGNYKPKQIQENNKMSQSNDDGFQNTVANKKQNRRA
SYSSEDDVIEKLPIYLGIFFDEDNNAAGKIKKILLESVEQLFNFDKINQIKTLWESINQL
YDTKGGKYNGWQLVKDPHVTVLYVGRDQERTESKIYQEFEEDLQESITVYGVVVVPGKII
TAICFPQHSVDNRCPHITLCTGEWQAKMSNDVLQESCSNPRGKSRKEWKS